KEGG   Rattus norvegicus (rat): 691380Help
Entry
691380            CDS       T01003                                 

Gene name
Psrc1
Definition
(RefSeq) proline and serine rich coiled-coil 1
  KO
K21443  proline/serine-rich coiled-coil protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    691380 (Psrc1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    691380 (Psrc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTSE1_N
Motif
Other DBs
NCBI-GeneID: 691380
NCBI-ProteinID: NP_001037767
RGD: 1585037
Ensembl: ENSRNOG00000020013
UniProt: Q3KR66
Position
2q34
AA seq 329 aa AA seqDB search
MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRGLSHRSNPNAVAPALQ
GVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDSENAAAGPGRPSPRGKPSPRRETFV
LKDSPVRDLLPTVSSWSAPPPSNLTGLRSSDKKGSARAGRVTAGKKPSSIKKESPTCNLF
SASKNPGRSPLAQPTLPPRRKTGSGARTVASPPIPVRPAPQSSASNSQCSSWLQGAAAKS
SSRLPFPSAIPKPAIRMPLTGRSIPAGKGALAPDPLPTQKGHPSTVGHRAPVSQRTNLPT
IGAARGRTSSAARGRVQPLRKAAVPGPTR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttgaaagaggatatcaagttcatcgtggatgagaccttggactttggaggg
ctgtccccatctgacagtcacgaggaagaagacatcacagtattagtgagtccagagaaa
ccactccgacgcggcctctcccatcggagtaacccaaacgcagtagctcccgccctccag
ggtgtgaggttcagcttaggcccgctcagcccagagaagctggaggagatccttgatgaa
gccaaccgcctggcagctcagctagaggagtgtgccctgaaagacagcgagaatgctgcc
gcaggccctgggaggcccagccccagagggaaacccagccctcggcgggagacatttgtc
ctaaaggacagccctgtccgagatctgctgcccactgtgagttcttggagtgccccacct
ccaagcaacttaactgggctccggagcagtgataaaaaggggtcagccagagctggtcgg
gtgacagctgggaagaagccctccagtataaagaaggaatcacccacttgcaatctgttc
tctgcatccaaaaacccagggcgttctcctcttgcacaaccaactcttcctcctcggcgg
aaaactgggtccggcgcacggacagtagcaagcccaccaatccctgtcaggccagctcca
cagtcctcagctagcaactcccagtgctcttcctggctgcagggagcagctgccaagtct
tcaagtcgactaccatttccctcagccatccccaagcctgccatccgaatgccactcact
ggacggagtataccggctggcaaaggtgccctagctcctgatcctctcccaactcagaaa
gggcatccaagcaccgtagggcacagagctcctgtttcccagcgaacaaatcttccaacc
attggtgctgctcgaggcaggacctccagtgccgctcgaggcagggtgcagcccctcagg
aaagctgcagtccctggacccacgaggtaa

DBGET integrated database retrieval system