KEGG   Rattus norvegicus (rat): 691431Help
Entry
691431            CDS       T01003                                 

Gene name
Slc25a33
Definition
(RefSeq) solute carrier family 25 member 33
  KO
K15116  solute carrier family 25, member 33/36
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    691431 (Slc25a33)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   691431 (Slc25a33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 691431
NCBI-ProteinID: NP_001121046
RGD: 1583942
Ensembl: ENSRNOG00000016949
UniProt: B2RZ89
Position
5q36
AA seq 320 aa AA seqDB search
MATDTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTIS
GAGMVRPTSVTPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFN
GIFVPDSNTVHIFSAGSAAFVTNTLMNPIWMVKTRMQLERKMRGCKQMNTLQCARHVYQT
EGIRGFYRGLTASYAGISETIICFALYESLKKCLKEAPIVSSTDGTEKSSSNFFGLMAAA
AVSKGCASCIAYPHEVIRTRLREEGSKYTSFMQTARLVFREEGYLAFYRGLFAQLIRQIP
NTAIVLSTYEFIVYLLGERA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggacactcagcagaaggagaacacgctgcttcatctcttcgccggcgggtgt
ggaggtacagttggtgctattttcacatgtccactagaagtcattaagacgagactgcag
tcttcgagactagctcttcggacggtgtattatcctcaggttcatctggggaccattagt
ggagctggaatggtgagaccaacgtctgtgacgcctggactcctacaggttctgaaatcg
atcctggaaaaggagggaccaaagtcactctttagaggcttgggtccaaacttggttgga
gttgcgccatccagggctgtgtacttcgcgtgctactccaaagccaaagagcagttcaat
ggcatcttcgtgcctgatagcaacactgtgcacattttctcagctggctctgcagctttt
gtcacaaataccttaatgaatcctatttggatggttaaaacgaggatgcagctagaacga
aagatgagaggctgcaagcagatgaataccctccagtgtgctcggcacgtgtaccagaca
gaaggcatccgtggcttctacagagggctgaccgcctcctatgctggcatctcagagaca
atcatctgctttgctctctatgagagtttaaagaagtgcttaaaagaagccccgatagtc
tcctccacggacggaacggagaaaagttcctccaacttctttggactgatggcggctgct
gctgtttctaaggggtgcgcctcctgcattgcttacccgcacgaggtcatcaggacacgg
ctccgggaagaaggcagcaagtacacgtcattcatgcagacagcacgcctggtattccgg
gaggaaggctatctcgccttctaccgaggactttttgctcagctcatccggcagatcccc
aatactgccattgtcctgtccacctacgagttcatcgtgtacctgctgggagagcgcgct
tag

DBGET integrated database retrieval system