KEGG   Rattus norvegicus (rat): 691447
Entry
691447            CDS       T01003                                 

Gene name
Ppp1r3e
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 3E
  KO
K07189  protein phosphatase 1 regulatory subunit 3A/B/C/D/E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04910  Insulin signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    691447 (Ppp1r3e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    691447 (Ppp1r3e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    691447 (Ppp1r3e)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     691447 (Ppp1r3e)
SSDB
Motif
Pfam: CBM_21 CBM53
Other DBs
NCBI-GeneID: 691447
NCBI-ProteinID: NP_001163046
RGD: 1583926
Ensembl: ENSRNOG00000014904
UniProt: F1LRU5
Position
15p13
AA seq 279 aa
MSHERPPRNDIPRNLSFIAALTERAYYRSQRPSLEEESEEEPGEGGTRPGARSRAHVPGR
GRRARSAPAGGGGARTARSRSPDTRKRVRFADALGLELAVVRRFRPGEPPRVPRHVQVQL
QRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGSARV
LDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLFALRY
RVTGREFWDNNGGRDYALLGPEHPGGAGAAEPQGWIHFI
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcccacgagcggccaccgcgcaatgacatcccccgcaacctgagctttatagcagca
ttgaccgagcgcgcgtactaccgcagccagcggcccagcctcgaggaggagtcggaggag
gagccgggggagggcgggacccggccgggcgcccgttcgcgggctcacgttccgggtcgg
gggcgcagggcccgctctgcgcccgcgggtggcggcggggcgcggacagcccgcagccgc
agccctgacactcgcaagagagtgcgtttcgccgacgcgctggggttggagctggctgtg
gtccgccgcttccgcccgggggaaccgccccgggtgccccgccacgtgcaggtgcaactg
cagagggacgccctgcgccacttcgcgccgtgcccgccgcgcacccgcggcctccaggac
gcgcgaatcgccctggagccagccctagagcccggcttcgccgcccggctgcaggcgcag
cgcatctgcctggaacgcgcagacgcgggccctctgggcgtggccgggagcgcgcgcgtg
ctggacctggcctacgagaagcgcgtgagcgtgcgctggagcgcggacggctggcgcagc
ctgcgggaatcgcccgcctcctacgccggtcctgccccggccccgccgcgggctgaccgc
ttcgccttccgcctgcctgcgcctccggtcggcggtgccctgctcttcgcccttcgctac
cgggttacgggccgcgagttctgggacaacaacggcggccgtgactacgcgctccttggg
cccgagcaccctggcggtgccggagctgcggagccccagggctggatccattttatttga

DBGET integrated database retrieval system