KEGG   Rattus norvegicus (rat): 691488Help
Entry
691488            CDS       T01003                                 

Gene name
Hist3h2bb
Definition
(RefSeq) histone cluster 3 H2B family member b
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    691488 (Hist3h2bb)
  Immune diseases
   05322 Systemic lupus erythematosus
    691488 (Hist3h2bb)
  Substance dependence
   05034 Alcoholism
    691488 (Hist3h2bb)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    691488 (Hist3h2bb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   691488 (Hist3h2bb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 691488
NCBI-ProteinID: NP_001103111
RGD: 1583885
Ensembl: ENSRNOG00000031790
UniProt: M0RBQ5
Position
10q22
AA seq 126 aa AA seqDB search
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggatccatccaaatcggctccagcccccaaaaaagggtccaaaaaggcggtcacc
aaggcgcaaaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcacccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggctcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcctggggagctggccaagcatgccgtgtcggaaggcaccaaggcagtcacc
aagtacaccagttccaagtga

DBGET integrated database retrieval system