KEGG   Rattus norvegicus (rat): 691516
Entry
691516            CDS       T01003                                 

Gene name
Il17c
Definition
(RefSeq) interleukin-17C precursor
  KO
K05491  interleukin 17C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    691516 (Il17c)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    691516 (Il17c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    691516 (Il17c)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   691516 (Il17c)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 691516
NCBI-ProteinID: NP_001178044
RGD: 1582798
Ensembl: ENSRNOG00000013007
UniProt: F1LTN0
Position
19
AA seq 203 aa
MATVTATVMCLLLLAWLPTGITHQDPPFWGKPRSHKTTLRCYSAEELSHGQAPPHLLTRS
ARWEQALPVALVASLEATGRRRQQEGPLPGTQCPVLRPEEVLEADTHERSISPWRYRIDT
DENRYPQKLAVAECLCRGCINAKTGRETAALNSVQLLQSLLVLRRRPCSQDGAADPTPGS
FTFHTEFIRVPVGCTCVLPRSTQ
NT seq 612 nt   +upstreamnt  +downstreamnt
atggccactgtcactgccactgtgatgtgtctcctgcttctagcctggttgcctactggg
ataacccaccaagatcccccattctgggggaaaccccgaagccataagacgacattgagg
tgctactcggctgaggagctctctcacgggcaggctcctccgcacctgctaactcgaagt
gccaggtgggagcaggccctccctgtggccctagtggccagtctggaggccacaggccgc
aggagacagcaagaaggacctctacctggaacacagtgccccgtgctgcggccagaggag
gtgctggaagctgacacccacgagcgctccatctcaccatggagatatcgcatcgacaca
gatgagaaccgctacccgcagaagctggcagtggcggaatgcttgtgtcggggttgcatc
aacgccaagacgggtcgcgagaccgctgccctgaactctgtgcagctgctgcagagccta
ctggtgctgagacgacggccctgctcccaagacggtgccgcagaccctacaccaggatct
ttcaccttccacactgagttcatccgcgtgcctgtcggttgcacctgtgttcttcccagg
tctacgcagtga

DBGET integrated database retrieval system