KEGG   Rattus norvegicus (rat): 691543Help
Entry
691543            CDS       T01003                                 

Gene name
Katnbl1
Definition
(RefSeq) katanin regulatory subunit B1 like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Katanin_con80
Motif
Other DBs
NCBI-GeneID: 691543
NCBI-ProteinID: NP_001103115
RGD: 1582771
UniProt: B1WBZ9
Position
3q34
AA seq 299 aa AA seqDB search
MAFDTHHVKKRNFSNSIDLPRKRISNFTSKNMKEVKISPKQLAAYISRTVGQAVKSPDKL
RKVLYHRKLVRHSFPNPCYKTKQSPRSGGCDMANKENELACAGHLPENLHHDSRTFVINT
SDSGSSQTENPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVALTFWRKRSVSELVAYLV
RIEDLGVVVDCLPVLTNSLQEEKQCISLGCCVDLFPLVKSLLQSRFEEYVIVGLNWLQAV
IKRWWSELSSKSEIISDGNIKILKQQLNGLWEQENHLTLVPGYTGNIAKDVDAYLLQLH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatactcaccatgttaaaaaacggaacttctctaatagtattgatcttcct
agaaagaggatctctaattttaccagtaagaacatgaaggaggttaagatatctccaaaa
cagttggctgcgtacataagtagaacagttggacaagcagtgaaaagcccagataagctg
cgcaaggtactctaccacagaaagttagttcgtcattcattcccaaatccttgttacaaa
actaagcagtcccctagaagtgggggctgtgacatggcaaataaagaaaatgaactggct
tgtgcaggccatctacctgaaaatttacaccatgacagtcggacatttgtcattaacacc
agtgattctgggtcttcacagacagaaaacccatcatcaaaatatagtggtttcttttct
gaggtttctcaggaccatgagacaatggcccaagttctattcagcaggaatttgagattg
aatgtagctttgactttctggagaaagagaagtgttagtgaacttgtagcttatttagtg
aggatagaagaccttggagttgtggtagattgccttcctgttctaaccaatagtttacag
gaagaaaagcaatgtatctctcttggctgctgtgtagacttatttcctctagtaaagtct
ttacttcaaagcagatttgaagaatatgtaattgttggcttaaactggcttcaagcagta
ataaaaaggtggtggtcagaactctcatctaaatcagaaattataagtgatggaaatatt
aagattttaaagcaacagttgaatggattatgggaacaggaaaaccatcttactttggtt
ccaggatatactggtaatatagctaaggacgtagatgcttatttattacagctgcattga

DBGET integrated database retrieval system