KEGG   Rattus norvegicus (rat): 691551Help
Entry
691551            CDS       T01003                                 

Definition
(RefSeq) similar to F28B3.5a
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_2
Motif
Other DBs
NCBI-GeneID: 691551
NCBI-ProteinID: XP_001078789
RGD: 1582763
Ensembl: ENSRNOG00000028473
UniProt: F1M4T5
Position
1q36
AA seq 514 aa AA seqDB search
MSEPLASQEHGRELLKGNHQPHLILGVWGWPVKAASPEKSYHSFKSIEFLKGTKISAWKM
TLLNIKSEAWAYSLITLGTEMLSSFFSFYYMKLFLEVYKISELAFYQSQVILMIWNILTD
LSGYFHMSSQNDCCLSYRCSLLGALLHAVAFLLPWFPWKHYRESDWLTGLQLVVSLCAFD
STHTWVQQAQCRLFAETSPRHESRLQLTRINQVASLVGSTSILFCGLISHNMEILPNFQA
IAVLIAFLALISFYSGMFHMRRFEFQRIPEENFLSESEQELAGTSVILLMRQILPQRNLY
LFLIMNFFQVFHLTFFSNFMMIFVDNLIPNKALSSSVRSIMYGAGFICPQCLVLLGQSWL
KTYGYYKVILLSFCLEGAAALVMLLLGQEHYFCLAVYLTVIMVIVHTSFCLFNLPVADMV
DADLLKCKRQSSLSLMVSVINALFTRSAQSLAPILILSKLSQHGYRELTSRTLLDLQDSM
FGLVCVISLGIATVQILTWSSFSISKRRDCPGMV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcccttggcctcccaggagcatggacgtgaactcctaaagggcaatcaccag
ccccacctcatacttggagtctggggctggccagtcaaagccgcctcccctgagaaaagt
taccacagttttaaaagcatagaatttcttaaaggcacaaaaatttctgcatggaaaatg
acacttttaaatattaaatctgaagcctgggcatactctctgattacactaggaactgaa
atgttaagttctttcttcagtttctactatatgaaacttttcttagaagtatacaagatt
tcagagctggccttctatcagtcccaggtaattttaatgatctggaatattctgactgac
ctgagtgggtatttccacatgagttctcagaatgactgctgtctcagttaccgttgctcc
ctgcttggagcccttctgcatgccgtggccttcttgctcccttggttcccttggaaacac
tatagagaaagtgactggcttaccggactccagctggtagtttccctgtgtgcatttgac
agcacccacacctgggtacagcaagcccagtgtcgcctgtttgcagagacttcccccagg
cacgagagcaggctgcagctgaccagaattaaccaggtggcatccctggtgggctccacc
agcatccttttctgtggcctcatctctcacaacatggaaatcctgcccaattttcaagcc
attgctgtcctcattgccttcctggctttgattagcttttacagtggcatgttccatatg
agacggtttgaatttcaaagaatcccagaggaaaatttcctctcagagagtgaacaggag
ttggcagggacctctgtcatcttactgatgagacaaatcttgcctcagaggaacctctac
cttttcctcatcatgaatttcttccaagtcttccatttgaccttcttcagtaacttcatg
atgatctttgtagacaacctcattcccaacaaggccctctcttcttccgtaaggagcatc
atgtatggggctggctttatctgtcctcagtgcctggtacttctaggtcagtcctggctg
aagacatacggttactataaggttattttactttctttctgcctagaaggggcagccgcc
cttgtcatgctacttctgggacaggaacactatttctgcttggctgtttacctcactgtt
atcatggtgattgtacacacctcgttttgcttatttaatttgccagtggctgacatggtc
gatgcagatttactgaagtgtaagaggcagtcttctctttccttgatggtttctgtcatc
aatgctttattcaccagatctgcccagtctttagcccccatattgatactgtctaagctc
agccagcatgggtacagagagctgaccagcagaacacttttagatctccaggacagcatg
tttggtttggtttgtgtcatttccctgggcatcgcaacagtgcagattctgacttggagc
tccttctccatcagcaagagaagagactgcccagggatggtgtaa

DBGET integrated database retrieval system