KEGG   Rattus norvegicus (rat): 691750Help
Entry
691750            CDS       T01003                                 

Gene name
Tmem107
Definition
(RefSeq) transmembrane protein 107
  KO
K22764  transmembrane protein 107
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    691750 (Tmem107)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    691750 (Tmem107)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM107 ODV-E18
Motif
Other DBs
NCBI-GeneID: 691750
NCBI-ProteinID: NP_001103118
RGD: 1595972
Ensembl: ENSRNOG00000006519
UniProt: D3ZFW5
Position
10q24
AA seq 140 aa AA seqDB search
MGRISGLVPSRFLTLLAHLVIVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLT
LGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFIFERWECTTYWYIFAFCSAF
PAVTETALFIAVFGLKKKPF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggatctccgggctcgtgccctctcgattcctgacgctcttggctcatctggtg
attgtcatcactttgttctggtcccgggaaagcaacatccaggcttgcctgcctctcaag
ttcaccccggaggaatatgagaagcaggacaaccaactggtagcagcgctctgcctcacc
ctgggcctctttgcagtggagctggctggcttcctctcaggagtctccatgtttaatagc
acccagagcctcctctccattgcagcccactgtagcgcgtctgtggccctatctttcttc
atattcgagcgatgggaatgtaccacgtactggtacatttttgccttctgcagcgctttt
ccagctgtcactgaaactgcgttattcatcgctgtctttgggctgaaaaagaaacccttc
tga

DBGET integrated database retrieval system