KEGG   Rattus norvegicus (rat): 691774
Entry
691774            CDS       T01003                                 

Gene name
Lpar6, P2ry5
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    691774 (Lpar6)
   04151 PI3K-Akt signaling pathway
    691774 (Lpar6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    691774 (Lpar6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    691774 (Lpar6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    691774 (Lpar6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    691774 (Lpar6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 691774
NCBI-ProteinID: NP_001039308
RGD: 1595950
Ensembl: ENSRNOG00000015577
UniProt: Q4G072
Position
15q11
AA seq 344 aa
MVSANGSHCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCF
CFVPYNINLILYSLVRTQTFVNCSVGAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKSWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtaagcgccaacggctcccactgcccttatgacgactcctttaagtacactttgtat
gggtgcatgttcagcatggtgtttgtgcttgggctgatatccaactgtgttgcgatatac
attttcatctgtgccctcaaagtgagaaacgaaactacaacgtacatgattaacctggca
atgtcagatttacttttcgtctttactttgccatttcggatcttttactttgcaacacgg
aattggccgtttggagatctgctctgtaagatttcagtaatgctgttttacaccaatatg
tatggaagcattctgttcttaacctgtatcagtgtagatcgatttctggcaattgtctac
ccatttaagtcgaagactttaagaactaaacgaaatgccaagattgtttgcattgctgtg
tggttcaccgtgatgggaggaagtgcgcctgcagttttctttcagtcgacccactctcag
ggtaacaatacctcagaagcctgctttgagaactttccagcagccacatggaaaacttat
ctctccaggattgtgattttcattgaaatagtggggttttttatccccctcattttgaac
gtaacgtgttctagtatggtgctaaggactttaaataagcctgttactttaagcagaagc
aaaatgaacaaaaccaaggttttaaaaatgatttttgtccacttggtcatattctgtttc
tgttttgtgccctataacatcaacctcattttgtattctctcgtgagaacacagaccttt
gttaactgctctgtgggggctgcagtgagaacgatgtaccccatcactctctgcattgct
gtctccaactgttgctttgaccccattgtttactacttcacttcagacacgatccagaac
tcaataaagatgaagagctggtctgttagaaggagtgactccaggttctctgaagttcag
ggcaccgagaattttatccaacacaacctacagaccttaaaaaataagatatttgataat
gaatctgcaatataa

DBGET integrated database retrieval system