KEGG   Rattus norvegicus (rat): 691931
Entry
691931            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC691931
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4605
Other DBs
NCBI-GeneID: 691931
NCBI-ProteinID: NP_001103121
RGD: 1593351
Ensembl: ENSRNOG00000010875
UniProt: D4A9Y2
Position
2q42
AA seq 129 aa
MCSARKLLRGGTGGGECDEDGAAPAGRAEEREPGASPLRGRPQDEGEQDAEEPQNHSGEP
IGDDYKKMGTLFGELNKNLLNMGFTRMYFGERIVEPVVVIFFWLMLWFLGLQALGLVAVL
CLVIIYVQQ
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtgctcggccaggaagctgctgcggggcggcaccggcggcggggagtgcgacgaggac
ggagcggcgccggcagggcgggctgaggagcgggagcccggggcgagcccgctgcgcggg
cggccgcaggacgagggcgagcaggatgctgaagaaccacaaaaccactctggcgaaccc
attggagatgactacaaaaagatgggaacgctttttggtgaactgaacaaaaacctcctc
aacatgggcttcacaaggatgtattttggagaacggattgtggaaccagtagtggtcatt
ttcttttggcttatgctatggttcctgggcctgcaagcccttggactggttgctgttctt
tgccttgtcattatttatgtacagcagtaa

DBGET integrated database retrieval system