KEGG   Rattus norvegicus (rat): 691979
Entry
691979            CDS       T01003                                 

Gene name
Esco2
Definition
(RefSeq) establishment of sister chromatid cohesion N-acetyltransferase 2
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    691979 (Esco2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     691979 (Esco2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    691979 (Esco2)
SSDB
Motif
Pfam: Acetyltransf_13 zf-C2H2_3
Other DBs
NCBI-GeneID: 691979
NCBI-ProteinID: XP_003751543
RGD: 1593313
Ensembl: ENSRNOG00000015921
Vega: OTTRNOG00000001035
UniProt: A0A096MJS9
Position
15p12
AA seq 595 aa
MMMATFTPRKRKRHTLKADNDDSLLTDISSSKLRFAENLYSSPNKKHNCQSSVQKEEKPC
SHQRHFSSSPLKTTENNMLSFANHSSLFKPVVSTVSFYNKNKHYLNPLERKLIRECKSIC
LATKNEDKPFPSVTEKIQRKPVCTKNKKRQKSLTANHQPNYKHVKSISRNLKNSKPSQVT
YKPVVDKENSCFPPENPPNSPPRVLSQKIRPRVTLQGGAAFFVRKRNFLKKSPLEDKPLP
ILLQKNEPEVTEDALEAKQVPKSLLVGEKSNVELLDARSESEEKLGKNSSGAVVSSKECK
LGKHNFPSEKSLENKTISSESVYSIFSVSSTNTKRSPSEEQSSVGSTACTNFLKQTNVQK
NINFRDTNKGGKDQLVIDAGQKHFGTTMCKSCGMIYTASNPEDEIQHLQHHHRFLEGIKY
VGWKRERIVAEFWDGKIVLVLPRDPSYAIKKVEDVQELVDLELGFQQVVPMCPNKTKTFL
FIDEKRVVGCLIAEPIKQAFRVLSEPSTTKECSRAWRCSDVPEPAICGISRIWVFKLKRR
KRIARRLVDTVRNCFMFGCFLSINEIAFSDPTPDGKLFATKYCNTPNFLVYNFHS
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgatgatggcaacttttactccaaggaagaggaagcgacatacactgaaggctgataat
gatgatagcctattaacagatatttcatcaagcaaactaagatttgctgaaaatctatat
tcatcacctaataagaaacataattgtcaaagcagtgttcaaaaggaagaaaagccatgc
tcccaccaacgacatttctcttcaagtccactcaaaacaactgaaaataatatgttgtca
tttgcaaaccacagctcgttatttaaaccagttgtgtctactgtatctttctacaataaa
aataagcactacctcaatccactggagaggaagttgataagagagtgtaaatctatttgt
ctagcaactaaaaatgaagataaaccttttcccagtgtgacagaaaaaattcagagaaaa
ccagtctgtaccaagaataaaaaaaggcagaagagtttaactgctaatcatcaaccaaat
tacaagcacgtcaagtctatatcaagaaacctgaaaaattccaagccaagtcaagtgacc
tataagccagttgtggacaaagagaacagttgttttcccccagaaaatcctccaaattct
cctcctcgggttctaagccagaaaataagaccacgagttacactccaaggtggagcagca
ttttttgttagaaaaagaaactttcttaaaaagtcacctctagaagataagccattacca
atacttttgcagaaaaatgaaccagaggtcactgaagatgcccttgaggcaaagcaagtc
ccaaagtccttgttagtgggagagaaatcaaatgttgagctactagacgcaagaagtgaa
agtgaagagaaactgggaaagaattcctcaggtgcagtagtttcttcaaaggagtgtaaa
cttggtaaacataattttccttcagagaagtcacttgagaacaagacaatttcttcggag
tctgtctattctatcttcagtgtttcttcaacgaacacaaaaaggtctccatctgaagaa
cagtcttctgtgggatccactgcatgtactaacttcttgaaacagacaaatgtacagaaa
aatattaatttcagagatacaaataaaggaggaaaagaccagcttgttattgacgcgggt
cagaaacattttgggacgactatgtgtaagtcttgtggcatgatctatactgcttccaac
cctgaagatgaaatacaacatctccaacatcaccaccgatttctggagggaattaaatat
gtgggatggaaaagagaacggatagtagcagagttttgggatgggaagattgtgttggtc
ctgccacgtgatccaagttatgccatcaaaaaggtagaggatgtccaagaacttgtggat
ctggaattgggcttccagcaagttgttcccatgtgtccaaacaaaaccaaaaccttcctc
tttattgatgaaaagagagtagttggatgtttaattgcggaacccatcaaacaggccttt
cgtgtcctgtcagaaccaagtaccactaaagaatgttctagagcttggcggtgttcagat
gtaccagaacctgcaatttgtggaataagtagaatctgggtcttcaaactaaaaagaaga
aaacgcattgcaagacgattggttgacactgtcaggaattgcttcatgtttggctgtttc
ctcagcattaatgaaattgcattttctgacccaacaccagatggcaaattatttgcaacc
aagtattgcaacacccctaatttccttgtatataattttcatagctaa

DBGET integrated database retrieval system