KEGG   Rattus norvegicus (rat): 691992
Entry
691992            CDS       T01003                                 

Gene name
Gp1ba
Definition
(RefSeq) platelet glycoprotein Ib alpha chain precursor
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    691992 (Gp1ba)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    691992 (Gp1ba)
   04611 Platelet activation
    691992 (Gp1ba)
   04613 Neutrophil extracellular trap formation
    691992 (Gp1ba)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    691992 (Gp1ba)
CD molecules [BR:rno04090]
 Proteins
  691992 (Gp1ba)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRRNT LRR_9
Other DBs
NCBI-GeneID: 691992
NCBI-ProteinID: NP_001103124
RGD: 1310239
Ensembl: ENSRNOG00000025959
UniProt: D3ZQU7
Position
10
AA seq 717 aa
MALLILLFLLPSPLHSQPTCDVSKVTSLLEVNCEDKKLKKLPTDLPADTGILHLSKNQLG
TFSTSYLVHFTHLTHLYLSRCELTSLQAHEKLLKLETLDLSHNHLQSLPSLGRALPALTT
LDVSFNKLGSLSPGALEGLGQLEELYLQNNDLKSLPPGLLMPTTKLLKLSLANNKLRELP
PGLLDGLEDLDTLYLQGNWLSTIPKGFFGSLLLPFVFLHANTWYCDCEILYFRNWLQENP
NRVYLWKEGVDVKAMTANVASVRCANLGNAPVYSYPGKGCPTNEGDIDYDDYADTPTTRT
EVKFSTNTKAHTTYWGLFYSESSTSPDSQMTSLPPIHEPTKKQPTFAHTEIPGFTTLPDT
MESNTAFYSLNNTVPTTTPEPTSTQATPEPSSTPMLTTPVPTPEPSSIPMLTVPVSTPEP
SSTPMLTTPVSTPEPSSIPMPTIPVPTPEPSSIPMPTIPVPTPEPSSTPMPTIPVPTPEP
SSTPMFTTPVPTPEPSSTPMLTTPTLTTPESSSTPSILVSTIPPVLTTTLAPPESIPKTV
LEQFYTLEPTLPRTLESTIIIPEQNSLNSQAVPQASSDTPKSNPFLNSDFCCLLPLGFYV
LGLLWLLFASVVLIVLLTWIWHVTPHNLDMDQSAALATSTHTTSLEMQRARQVTMPWAWL
LSLQGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGHGQDLLGRVGIRYSGHSL
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggctctcctcatcttgctgttcctgctgccaagtcccttacactcccagcccacttgt
gatgtctccaaagtgaccagcctgctggaagtaaactgtgaggacaagaagctgaaaaaa
ttgcctacagacctgccagccgacacaggcatcctccacctgagcaagaaccaactgggc
accttctccacatcatacctggtgcatttcactcaccttactcacctgtacctgagtaga
tgtgagctgaccagcctgcaggcccatgagaaactgttaaagctggaaaccctggactta
tcccacaatcacctgcaaagtctgccctccctaggacgggcactgcctgcactcactact
ctagacgtctccttcaacaagctgggttcactgtctcctggtgccctggaaggcctgggc
caactcgaggaactctacttgcagaacaatgatcttaagagtctgccccctgggctctta
atgcccacaactaagctgttgaaactcagtctggccaacaacaaacttcgtgagctgccc
cctgggctcctagatggactagaggatcttgacaccctctaccttcaagggaactggctc
agcacaataccaaagggcttctttgggtccctcctcttgccttttgtttttctccatgcc
aacacctggtactgtgattgtgaaatcctctacttccgtaactggctccaagaaaacccc
aaccgtgtctacttatggaaggagggtgtagatgtcaaggccatgactgctaacgtggcc
agtgtacgatgtgccaatttgggcaatgcgcctgtctactcctacccagggaagggctgc
cctaccaatgagggtgacatagactatgatgactatgctgatacccctaccacaaggact
gaggtgaagttctctactaacactaaagctcatactacctactggggcctattctactca
gagtcttccacttctccagacagccaaatgacttctttgcctcccatccacgaacccact
aagaaacaacctacatttgcccacacagagatcccaggtttcaccacactcccagatacc
atggaatccaacacagccttctacagtctaaacaatactgtacccaccaccaccccagag
cccacctccacccaggctaccccagagcccagcagcaccccaatgcttaccactcctgtg
cctaccccagagcccagcagcatcccaatgcttaccgttcctgtgtctaccccagagccc
agcagcaccccaatgcttaccactcccgtgtctaccccagagcccagcagcatcccaatg
cctaccattcccgtgcctaccccagagcccagcagcatcccaatgcctaccattcccgtg
cctaccccagagcccagcagcaccccaatgcctaccattcctgtgcctaccccagagccc
agcagcaccccaatgtttaccacacctgtgcctaccccagagcccagcagtaccccaatg
cttaccactcccaccctgactaccccagagtccagcagcaccccaagtattctagtgtct
actatccccccagtgctcactaccaccctggcccctccagagtctatcccaaagaccgtt
ttagaacaattttataccctagagcccactttaccccgtaccttagaatccacaataata
atcccagagcagaatagtctaaattcccaagcggtgcctcaagcaagttctgatactcct
aaaagcaatccttttctcaactctgacttctgttgcctcctccccctgggcttctatgtt
ctgggtctcctctggctcttatttgcctctgtggtcctcattgtgttgctgacctggatc
tggcatgtgacaccgcacaatctagacatggaccaatctgctgcactggccacaagcaca
cacaccacaagcctggaaatgcagagagcaaggcaagtaactatgccctgggcctggctg
ctctcccttcaaggatcactccctactttccggtctagccttttcctgtgggtaaggcct
aatgggcgtgtggggcctctggtagcaggacggagaccctcagctctgagtcagggtcat
ggtcaggacctattgggcagagtgggtattaggtactcaggccacagtctgtga

DBGET integrated database retrieval system