KEGG   Rattus norvegicus (rat): 767613Help
Entry
767613            CDS       T01003                                 

Gene name
Gpr17
Definition
(RefSeq) G protein-coupled receptor 17
  KO
K08404  G protein-coupled receptor 17
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    767613 (Gpr17)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    767613 (Gpr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Srx Cytochrom_B_C
Motif
Other DBs
NCBI-GeneID: 767613
NCBI-ProteinID: NP_001065245
RGD: 1589785
Ensembl: ENSRNOG00000025745
UniProt: Q09QM4
Position
18p12
AA seq 339 aa AA seqDB search
MDGLETALPSLTDNASLAYSEQCGQETPLENMLFACFYLLDFILAFVGNALALWLFIWDH
KSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFLFYLNMYASIY
FLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWIVVAVAMAPLLVSPQTVQTNHTVV
CLQLYREKASHHALASLAVAFTFPFITTVTCYLLIIRSLRQGPRIEKHLKNKAVRMIAMV
LAIFLICFVPYHIHRSVYVLHYRGGGTSCSAQRALALGNRITSCLTSLNGALDPVMYFFV
AEKFRHALCNLLCSKRLTGPPPSFEGKTNESSLSARSEL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatggcctcgagacagccctaccgagtctgactgacaatgcctccctggcttactct
gaacaatgtggccaagagacgcccctggagaacatgctcttcgcctgcttctacctcctg
gacttcatcctagcttttgtgggcaacgctctggccctctggcttttcatctgggatcac
aagtcaggcactccggccaacgtgttcctaatgcacctggctgtggccgacttgtcctgt
gtgctggtcctgcctacccggttggtttatcacttctctggcaatcactggccttttggg
gaaatcccgtgccgactcactggcttcctcttctacctgaatatgtacgccagcatctac
ttcctcacctgcatcagtgctgaccggttcctggccattgtgcacccagtcaagtccctc
aagcttcgaagacctctctatgcccacctggcctgcgccttcctgtggatcgtggtggcc
gtggctatggccccactgctagtgagtccgcagactgtgcagaccaaccacacggttgtc
tgcctgcaactgtaccgggagaaggcctcccatcatgccctggcttccctggctgtggct
tttaccttccccttcatcaccacggtcacctgctacctgctgatcattcgcagcctccgc
cagggtccccgtatagagaagcacctcaagaataaagccgtccgcatgattgctatggtt
ctggccatcttcctgatttgttttgtgccctaccacatccaccgttcagtctatgtgctt
cactaccgcggtggtgggacttcgtgctcagctcagcgtgccctggccctagggaaccgg
atcacctcctgcctcaccagcctcaacggggccctggatccagtcatgtacttctttgtg
gctgagaaattccgccacgccttgtgcaacttgctctgcagcaaacgactcacaggtcct
cctcccagctttgaagggaaaaccaacgagagctccctgagcgctcggtctgagctgtga

DBGET integrated database retrieval system