KEGG   Rattus norvegicus (rat): 78956
Entry
78956             CDS       T01003                                 

Gene name
Scn9a
Definition
(RefSeq) sodium channel protein type 9 subunit alpha
  KO
K04841  voltage-gated sodium channel type IX alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    78956 (Scn9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    78956 (Scn9a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   78956 (Scn9a)
SSDB
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH IQ
Other DBs
NCBI-GeneID: 78956
NCBI-ProteinID: NP_579823
RGD: 69368
Ensembl: ENSRNOG00000006639
UniProt: O08562
Position
3
AA seq 1984 aa
MAMLPPPGPQSFVHFTKQSLALIEQRISEEKAKEHKDEKKDDEEEGPKPSSDLEAGKQLP
FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKAIFRFNATPALYMLSPFSPLRRISI
KILVHSLFSMLIMCTILTNCIFMTLSNPPEWTKNVEYTFTGIYTFESLIKILARGFCVGE
FTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQ
SVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRKELEENETLESIMNTAESEEELK
KYFYYLEGSKDALLCGFSTDSGQCPEGYICVKAGRNPDYGYTSFDTFSWAFLALFRLMTQ
DYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKE
LEFQQMLDRLKKEQEEAEAIAAAAAEFTSIGRSRIMGLSESSSETSRLSSKSAKERRNRR
KKKKQKMSSGEEKGDDEKLSKSGSEESIRKKSFHLGVEGHHRTREKRLSTPNQSPLSIRG
SLFSARRSSRTSLFSFKGRGRDLGSETEFADDEHSIFGDNESRRGSLFVPHRPRERRSSN
ISQASRSPPVLPVNGKMHSAVDCNGVVSLVDGPSALMLPNGQLLPEVIIDKATSDDSGTT
NQMRKKRLSSSYFLSEDMLNDPHLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHTF
LIWNCSPYWIKFKKLIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAVGNL
IFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLIELFLADVEGLSVLRSFRLLR
VFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINV
DCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVYMMVMVIGNLVVLN
LFLALLLSSFSSDNLTAIEEDTDANNLQIAVARIKRGINYVKQTLREFILKSFSKKPKGS
KDTKRTADPNNKKENYISNRTLAEMSKDHNFLKEKDRISGYGSSLDKSFMDENDYQSFIH
NPSLTVTVPIAPGESDLEIMNTEELSSDSDSDYSKEKRNRSSSSECSTVDNPLPGEEEAE
AEPVNADEPEACFTDGCVRRFPCCQVNVDSGKGKVWWTIRKTCYRIVEHSWFESFIVLMI
LLSSGALAFEDIYIEKKKTIKIILEYADKIFTYIFILEMLLKWVAYGYKTYFTNAWCWLD
FLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIM
NVLLVCLIFWLIFSIMGVNLFAGKFYECVNTTDGSRFPTSQVANRSECFALMNVSGNVRW
KNLKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSVNVNEQPKYEYSLYMYIYFVIFII
FGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGN
KFQGCIFDLVTNQAFDITIMVLICLNMVTMMVEKEGQTEYMDYVLHWINMVFIILFTGEC
VLKLISLRHYYFTVGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLFRVIRLARIGRILR
LIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGINDMFNFE
TFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPKKVHPGSSVEGDCGNPSVGIFYFVS
YIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFCKL
SDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRSQ
MEERFMSANPSKVSYEPITTTLKRKQEEVSATIIQRAYRRYRLRQHVKNISSIYIKDGDR
DDDLPNKEDTVFDNVNENSSPEKTDVTASTISPPSYDSVTKPDQEKYETDKTEKEDKEKD
ESRK
NT seq 5955 nt   +upstreamnt  +downstreamnt
atggcgatgctgcctcctccaggacctcagagtttcgttcacttcacaaaacagtccctt
gccctcattgaacagcgtatttctgaagaaaaagccaaggaacacaaagacgaaaagaaa
gatgatgaggaagaaggccccaagcccagcagtgacttggaagctgggaaacagctcccc
ttcatctatggagacattccccctggaatggtgtcagagcccctggaggacctggaccca
tactatgctgacaaaaaaacttttatagtattgaacaaagggaaagcaatcttccgtttc
aacgccacccctgctttgtacatgctgtctcccttcagtcctctaagaagaatatctatt
aagatcttagtgcactccttattcagcatgctaatcatgtgcacaattctgacgaactgc
atattcatgaccttgagcaaccctccagaatggaccaaaaatgtagagtacacttttact
gggatatatacttttgaatcactcataaaaatccttgcaagaggcttttgcgtgggagaa
ttcaccttcctccgtgacccttggaactggctggactttgttgtcattgtttttgcgtat
ttaacagaatttgtaaacctaggcaatgtttcagctcttcgaactttcagagtcttgaga
gctttgaaaactatttctgtaatcccaggactaaagaccatcgtgggggccctgatccag
tcagtgaagaagctctctgacgtcatgatcctcactgtgttctgtctcagtgtgtttgca
ctaattggactacagctgtttatgggcaacttgaagcataaatgtttcaggaaggaactc
gaagagaatgaaacattagaaagtatcatgaatactgctgagagtgaagaagaattgaaa
aaatatttttattacttggagggatccaaagatgctctactctgcggcttcagcacagat
tcagggcagtgtccagaaggctacatctgtgtgaaggctggcagaaacccggattatggc
tacacgagctttgacacattcagctgggccttcttggccttgtttcggctaatgactcag
gactactgggagaacctttaccaacagactctgcgtgctgctggcaaaacctacatgatt
ttctttgtcgtggttatttttctgggctccttttacctgataaacttgatcctggctgtg
gtagccatggcgtatgaggaacagaaccaggccaacatcgaagaagctaaacagaaagag
ttagaatttcagcagatgttagaccgactcaaaaaggagcaggaagaagctgaggcgatc
gctgcagccgctgctgagttcacgagtatagggcggagcaggatcatgggactctctgag
agctcttcagaaacctccaggctgagctcaaagagtgccaaggagagaagaaaccgaaga
aagaaaaagaaacagaagatgtccagtggcgaggaaaagggtgacgatgagaagctgtcc
aagtcaggatcagaggaaagcatccgaaagaaaagtttccatctcggtgtggaagggcac
caccggacccgggaaaagaggctgtccacccccaaccagtcgccactcagcattcgtggg
tccctgttttctgccaggcgcagcagcaggacgagtctgttcagttttaaggggcgagga
agagatctgggatctgagacagaattcgctgatgatgagcatagcatttttggagacaac
gagagcagaaggggttcactattcgtaccccatagaccccgggagcggcgcagcagtaac
atcagtcaggccagtaggtccccgccagtgctaccggtgaacgggaagatgcacagtgca
gtggactgcaatggcgtcgtgtcgcttgttgatggaccctcagccctcatgctccccaat
ggacagcttcttccagaggtgataatagataaggcaacttccgacgacagcggcacgact
aatcagatgcgcaaaaaaaggctctctagttcttacttcttgtctgaggacatgctgaat
gacccgcatctcaggcaaagggccatgagcagggcgagcatactgaccaacactgtggaa
gaacttgaagaatctagacaaaaatgtccaccatggtggtacagatttgctcacacattt
ttaatctggaattgctctccatattggataaaattcaaaaagctcatctattttattgtg
atggatccttttgtagatcttgcaattaccatttgcatagttttaaacaccttatttatg
gctatggagcaccacccaatgactgaagaattcaaaaatgtccttgcagtggggaacttg
atctttacagggatcttcgcagctgaaatggtactgaagttaatagccatggacccctat
gagtatttccaagtagggtggaatatttttgacagcctaattgtgacgctgagtttgata
gagcttttcctagcagatgtggaaggattatcagttctgcggtcattcagattgctccga
gtcttcaagttggcaaagtcctggcccacactgaacatgctcattaagatcatcggcaac
tcggtgggcgcactgggcaacctgaccctggtgctggccatcatcgtcttcatttttgcc
gtggtcggcatgcagctgtttggaaagagctacaaggagtgtgtctgcaagatcaatgtg
gactgcaagctgccgcgctggcacatgaacgacttcttccactccttcctgatcgtgttc
cgagtgctgtgtggggagtggatagagaccatgtgggactgcatggaggtcgcgggccag
accatgtgccttattgtttacatgatggtcatggtgattgggaaccttgtggtcctgaac
ctgtttctggctcttttgctgagttcatttagttctgacaatcttacagcaattgaggaa
gacaccgatgcaaacaacctccagatcgcagtggccagaattaagaggggaatcaattat
gtgaaacagaccctgcgtgaattcattctaaaatcattttccaaaaagccaaagggctcc
aaggacacaaaacgaacagcagatcccaacaacaagaaagaaaactatatttcaaaccgt
acccttgcggagatgagcaaggatcacaatttcctcaaagaaaaggataggatcagtggt
tatggcagcagtctagacaaaagctttatggatgaaaatgattaccagtcctttatccat
aaccccagcctcacagtgacagtgccaattgcacctggggagtctgatttggagattatg
aacacagaagagcttagcagtgactcagacagtgactacagcaaagagaaacggaaccga
tcaagctcttctgagtgcagcactgttgacaaccctctgccaggagaagaggaggctgaa
gcagagcccgtaaacgcagatgagcctgaagcctgctttacagatggttgtgtgaggaga
tttccatgctgccaagttaatgtagactctgggaaagggaaagtttggtggaccatcagg
aagacgtgctacaggatagttgaacacagctggtttgaaagcttcatcgttctcatgatc
ctgctcagcagtggagctctggcttttgaagatatctatattgaaaagaaaaagaccatt
aagattatcctggagtatgctgacaagatattcacctacatcttcattctggaaatgctt
ctaaaatgggtcgcatatgggtataaaacatatttcactaatgcctggtgttggctggac
ttcttaattgttgatgtgtctctagttactttagtagccaacactcttggctactcagac
cttggccccattaaatctctacggacactgagggccctaagacccctaagagccttgtct
agatttgaaggaatgagggtagtggtcaacgcactcataggagcaatcccttccatcatg
aacgtgcttctcgtgtgccttatattctggctaatatttagcatcatgggagtcaatctg
tttgctggcaagttctatgagtgtgtcaacaccaccgatgggtcacgatttcctacatct
caagttgcaaaccgttctgagtgttttgccctgatgaacgttagtggaaatgtgcgatgg
aaaaacctgaaagtaaacttcgacaacgttgggcttggttacctgtcgctgcttcaagtt
gcaacattcaagggctggatggatattatgtatgcagcagttgactctgttaatgtaaat
gaacagccgaaatacgaatacagtctctacatgtacatttactttgtcatcttcatcatc
ttcggctcattcttcacgttgaacctgttcattggtgtcatcatagataatttcaaccaa
cagaaaaaaaagcttggaggtcaagatatctttatgacagaagaacagaagaaatactat
aatgcaatgaagaagcttgggtccaagaaaccacaaaaaccaattccaaggccagggaac
aaattccaaggatgtatatttgacttagtgacaaaccaagcttttgatatcaccatcatg
gttcttatatgcctcaacatggtaaccatgatggtagaaaaagaggggcaaactgagtac
atggattatgttttacactggatcaacatggtcttcattatcctgttcactggggagtgt
gtgctgaagctaatctccctcagacattactacttcactgtgggttggaacatttttgat
tttgtggtagtgatcctctccattgtaggaatgtttctcgctgagatgatagagaagtat
ttcgtgtcccctaccctgttccgagtcatccgcctggccaggattggacgaatcctacgc
ctgatcaaaggcgccaaggggatccgcactctgctctttgctctgatgatgtcccttcct
gcgctgttcaacatcggcctcctgcttttcctggtcatgttcatctacgccatctttggg
atgtccaactttgcctacgttaaaaaggaggctggaattaatgacatgttcaactttgag
acttttggcaacagcatgatctgcttgttccaaatcaccacctctgcgggctgggacgga
ctgctggcccccatcctcaacagcgcacctcctgattgtgaccctaaaaaagttcaccca
ggaagttcagtggaaggggactgtgggaacccatccgtggggattttctactttgtcagc
tacatcatcatatccttcctggtggtggtgaacatgtacatcgctgtcatcctggagaac
ttcagtgttgccaccgaagagagcactgagcctctgagtgaggacgactttgagatgttc
tacgaggtctgggagaagttcgaccctgacgccactcagttcatagagttctgcaagctt
tctgactttgcagctgccctggatcctcccctcctcatcgcaaagccaaacaaagtccag
ctcattgccatggacctgcccatggtgagtggagaccgcatccactgcctggacatcttg
tttgcttttacaaagcgggtcctgggtgagggtggagagatggattctcttcgttcacag
atggaagaaaggttcatgtcagccaatccttctaaagtgtcctatgaacccatcacgacc
acactgaagagaaaacaagaggaggtgtccgcgactatcattcagcgtgcttacagacgg
tatcgcctcagacaacacgtcaagaatatatcgagtatatacataaaagatggagacagg
gatgatgatttgcccaataaagaagatacagtttttgataacgtgaacgagaactcaagt
ccggaaaagacagatgtaactgcctcaaccatctcgccaccttcctatgacagtgtcaca
aagccagatcaagagaaatatgaaacagacaaaacagagaaggaagacaaagagaaagat
gaaagcaggaaatag

DBGET integrated database retrieval system