KEGG   Rattus norvegicus (rat): 78963Help
Entry
78963             CDS       T01003                                 

Gene name
Apaf1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05016  Huntington disease
rno05134  Legionellosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    78963 (Apaf1)
   04215 Apoptosis - multiple species
    78963 (Apaf1)
   04115 p53 signaling pathway
    78963 (Apaf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    78963 (Apaf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    78963 (Apaf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    78963 (Apaf1)
   05012 Parkinson disease
    78963 (Apaf1)
   05014 Amyotrophic lateral sclerosis (ALS)
    78963 (Apaf1)
   05016 Huntington disease
    78963 (Apaf1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    78963 (Apaf1)
   05152 Tuberculosis
    78963 (Apaf1)
  09172 Infectious disease: viral
   05162 Measles
    78963 (Apaf1)
   05164 Influenza A
    78963 (Apaf1)
   05161 Hepatitis B
    78963 (Apaf1)
   05160 Hepatitis C
    78963 (Apaf1)
   05168 Herpes simplex virus 1 infection
    78963 (Apaf1)
   05169 Epstein-Barr virus infection
    78963 (Apaf1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    78963 (Apaf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like eIF2A CARD_2 AAA_16 Utp8 Nup160 AAA_22 NACHT
Motif
Other DBs
NCBI-GeneID: 78963
NCBI-ProteinID: NP_076469
RGD: 620575
Ensembl: ENSRNOG00000008022
UniProt: Q9EPV5
Position
7q13
AA seq 1249 aa AA seqDB search
MDAKARNCLLQHKEALEKDIKTSYIMDHMISNGVLTVVEEEKVKSQATQYQRAAALIKMI
LNKDNYAYISFYNALLHEGYKDLAGLLHSGLPLVSSSSGKDTDGGNTSFVRTVLCEGGVP
QRPVIFVTRKKLVSAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHALLEGCFSG
GVHWVSIGKQDKSGLLMKLQNLCTRLGQEESFSQRLPLNIEEAKDRLRVLMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVIPVESGLGKEKGLEILSLFVN
MKKEDLPVEAHSIIKECKGSPLVVSLVGALLRDFPNRWAYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCVLWDLETEEVEDILQEFVN
KSLLFCNRNGKSFCYYLHDLQVDFLTEKNRSQLQDLHRKMVTQFQRYHQPHTLSPGQEDC
MYWYNFLAYHMASAGMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDTGRLYLEWINK
KTIKNLSRLVVRPHTDAVYHACFSQDGQRIASCGADKTLQVFKAETGEKLLDIKAHEDEV
LCCAFSSDDSYIATCSVDKKVKIWDSGTGKLVHTYEEHSEQVNCCHFTNKSNHLLLATGS
NDSFLKLWDLNQKECRNTMFGHTNSVTHCRFSPDDELLASCSADGTLKLWDVRSANEKKS
INVKRFFLSSEDPPEDVEVIVKCCSWSADGDRIIVAAKNKVLLLDIHTSGLLTEIHTGHH
STIQYCDFSPYDHLAVIALSQYCVELWNIDSRVKVADCRGHLSWVHGVMFSPDGSSFLTA
SDDQTIRVWETRKVCKNSAIVLKQEIDVVFQENEMMVLAVDNIRGLQLIAGKTGQIDYLP
EAQVSCCCLSPHLEYVAFGDEEGAIKIIELPNNRVFSSGIGHKKAVRHIQFTADGKTLIS
SSEDSVIQVWNWQTEEYVFLQAHQETVKDFRLLRDSRLLSWSFDGTVKVWNVITGRIERD
FTCHQGTVLSCAISSDATKFSSTSADKTAKIWSFELPSPLHELKGHNSCVRCSAFSLDGI
LLATGDDNGEIRIWNVSDGQLLHLCAPISIEEGTATHGGWVTDVCFSPDRKMLVSAGGYL
KWWNVVTGESSQTFYTNGTNLKKIHVSPDFRTYVTVDNLGILYILQVLE
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaggcccgaaattgtttgcttcaacataaagaagctctggaaaaggacatc
aaaacatcctacatcatggatcacatgatcagtaatggcgtcttaacagtagtagaggag
gaaaaggtcaaaagtcaggccactcaatatcaacgagcagctgctttaattaaaatgata
cttaataaagacaattatgcctacatttcattctacaacgctctactacacgagggctat
aaagaccttgctggacttctgcatagcggccttcctcttgtgtcttcttccagcggcaag
gacacagacggtggaaacacttcatttgtaaggacagtgctgtgtgaaggtggagtgcca
cagaggccagtcatctttgtcactaggaagaagctggtcagtgcgattcagcagaagctc
tggaaactgaatggggagccagggtgggtcaccatctatggaatggcaggctgtggcaag
tctgtattagctgcggaagctgttcgcgaccatgccctcctagaaggttgtttttcaggg
ggcgtacactgggtttccatcggaaaacaagacaagtccgggcttctaatgaagctgcag
aatctttgcacgcggttgggtcaagaagagagtttctctcagaggctcccgcttaacatt
gaggaggccaaagaccgtctccgtgttctgatgctgcgaaaacacccaaggtctctgttg
atcttggatgacgtttgggatccttgggtgttaaaggcttttgacaaccagtgtcagatt
cttcttaccaccagagataagagtgttaccgattcagtaatgggtcctaagtatgttatc
cctgtggagagtggtctagggaaagagaagggacttgaaatcttgtcactttttgttaat
atgaagaaagaagatctgccagtggaggctcacagtattataaaggagtgcaaaggctct
cctctcgtcgtgtctttagttggtgcgcttttacgggattttcccaatcgctgggcatac
tacctcaggcagcttcagaataagcagtttaagagaataaggaaatcttcatcttatgac
tacgaggctctggatgaagccatgtccataagtgtggagatgctcagagaagacatcaag
gactactacacagacctctccatccttcagaaggatgtcaaggtgcctacgaaggtgctg
tgtgttctctgggacttggaaacggaagaagttgaagacatcttgcaggagttcgttaat
aagtctctcttattctgtaatcggaatgggaagtcattttgttattatttacacgatctt
caagtagatttccttacagagaagaatcgaagtcagctccaggatctgcacaggaagatg
gtcactcaatttcagaggtatcaccagccgcatacgctgtctccaggtcaggaggactgc
atgtactggtacaacttcctggcctatcatatggccagtgccggtatgcacaaagaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtcggccctgcg
catctgattcatgagttcgtggaatataggcatatactggatgaaaaggattgtgcagtc
tgtgagaattttcaggagtttttatctttaaacggacaccttcttggacgacagccattt
cctaacattgtgcaactgggcctctgtgaaccagagacttccgaagtttatcaacaagca
aagctgcaggccaagcaggaggtggataccgggcggctttacctggaatggatcaacaaa
aaaaccatcaagaatctgtcccgcttagtcgttcgcccccatacagacgccgtgtaccat
gcgtgtttttctcaggatggtcagagaatagcttcttgtggagctgataaaaccttgcag
gtgtttaaagccgagacaggagagaaacttcttgacattaaagctcatgaagatgaggtg
ctttgctgtgcgttctcctcagatgacagttacatagcaacctgctcagtggataagaaa
gttaagatttgggattctgggactgggaagctagtgcacacctacgaagaacactcagag
caggtcaattgctgccatttcaccaataagagcaaccaccttcttttggccaccgggtca
aatgactccttccttaagctctgggatttgaatcaaaaagaatgccgaaataccatgttc
ggtcacacgaactcagtcacccactgcaggttctcaccagacgatgagctcttggcgagt
tgctcagccgacgggactttaaagctttgggatgtgagatcagcaaacgagaagaaaagc
attaatgtgaagcgcttcttcctgagttcagaagacccaccagaggacgtggaggtgatc
gtgaaatgttgctcctggtctgcagatggcgacagaataatagtggcagcaaaaaacaaa
gtcctccttcttgatattcatactagtggcctgctgactgagatccacacaggtcatcac
agcaccatccagtactgtgacttctccccctacgaccatttggcagtgattgccctgtct
cagtactgtgtggagttgtggaacatagactcccgggtaaaggtggctgactgcagggga
catttaagttgggtccacggtgtgatgttttctcctgatggctcctcgttcttgacagct
tctgatgaccaaacaataagggtctgggagacaagaaaggtgtgcaagaactctgccatt
gtgttaaagcaggaaatagatgtcgtgtttcaagaaaacgaaatgatggtccttgcagtt
gacaacataagaggcctacaactcattgctggaaaaacaggccagattgattacctgcct
gaagcccaagtgagttgctgctgcctaagtccacatcttgagtacgttgcatttggagat
gaagagggagccattaagattatagaacttccaaacaacagagttttcagctctgggatt
gggcacaagaaagctgtacggcacatccagttcacagctgatgggaagacactgatttca
agttctgaagactctgtgattcaggtgtggaattggcagacagaggagtatgtatttctg
caagcccatcaggaaacagtaaaggacttcagactcctgagagattcacgattgctttcc
tggtcattcgatggaacggtgaaggtgtggaatgtcattaccggaagaattgaaagagac
tttacttgtcatcagggcacagtgctttcctgtgctatctcttctgatgccaccaagttt
tcatctacctcagctgataagaccgccaagatctggagttttgaactcccttcccctctt
catgagctgaagggccataacagctgtgtccgctgctctgccttctcgctggatggcatc
ctgttagcaactggagatgacaatggagaaatcaggatatggaatgtctcagatggccag
cttcttcatttgtgtgctccgatttccatagaagaaggaacggctacccacggaggctgg
gtgactgatgtttgcttctctcctgacagaaaaatgcttgtctctgccggaggatacctt
aagtggtggaatgttgttactggggagtcctcacagaccttctacaccaatggaacaaac
ctcaagaaaatacatgtgtcccctgacttcagaacatatgtgaccgttgataatcttggt
attttatatattttacaggttttagagtaa

DBGET integrated database retrieval system