KEGG   Rattus norvegicus (rat): 78965Help
Entry
78965             CDS       T01003                                 

Gene name
Csf1
Definition
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno04668  TNF signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    78965 (Csf1)
   04015 Rap1 signaling pathway
    78965 (Csf1)
   04010 MAPK signaling pathway
    78965 (Csf1)
   04668 TNF signaling pathway
    78965 (Csf1)
   04151 PI3K-Akt signaling pathway
    78965 (Csf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    78965 (Csf1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    78965 (Csf1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    78965 (Csf1)
  09158 Development
   04380 Osteoclast differentiation
    78965 (Csf1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    78965 (Csf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    78965 (Csf1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   78965 (Csf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSF-1
Motif
Other DBs
NCBI-GeneID: 78965
NCBI-ProteinID: NP_076471
RGD: 621063
Ensembl: ENSRNOG00000018659
UniProt: Q6GMN4
Position
2q34
AA seq 566 aa AA seqDB search
MTARGAAGRCPSSTWMGSRLLLVCLLVSRSVAEVSEHCSHMIGNGHLQILQQLIDSQMET
ACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNS
CFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSR
DVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPL
RIEDPGSAKQRPPRSTCQTLESTEQPNHEDPQPHPSAGAPIPGVEDIIESSMGTNWVLEE
ASGEASEGFLTQERKFSPSNPVGGSIQAETDRPWARSASSPFPKLTEDQQPTNITDTPLT
EVNPMRPTGQTLNNTPEKTDGSSTLREDQQEPRSPHFATLNPQRVGNSATPYAKLLPPKS
HSWGIVLPLGELEGKKSTRDRRSPAELKGGPASEGAARPVAQSTRDRRSPAELKGGPASE
GAARPVARFNSIPLTDTGSSIQDPQTSAFVFWVLGIILVLLAVGGLLFYSWKRRSHRDPR
TLDSSVGRPEGSSLAQDEDRQVELPV
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgcggggcgctgcccttcttcgacatggatgggctcccggctg
ctgctggtctgtctcctcgtgagcaggagtgttgccgaggtgtcggagcactgtagccac
atgattgggaatggacacctacagattttgcagcagttgatcgacagccaaatggagact
gcatgcctgatcgaatataaatttgtagaccaggaacagctggacgatcccgtttgctac
ctaaagaaggcctttgttttggtacaagtcataatcgaggaaaccatgcgctttaaagac
aacacccccaacgccaacgccaccgagaggctacaggaactctctatgaaactgaacagc
tgctttatcaaggactataaggaacagaacgaggcctgtgtccaaacttacaaagagagt
cctctccggttgctggagaaaatcaagaatttctttaacgaaacaaagaatttccttgaa
aaggactggaatatttttagcaagaactgcaatgacagccttgctaaatgctctagcaga
gatgtggtgaccaagcctgattgcaactgcctgtaccctaaagccacccctagcagcgac
ctggcctctgcctcccctcaccagccccctgccccctccatggcccctctggctgacttg
gcttgggatgattctcagaggacagagggaagctccctcttgcccagtgatctgcctctt
cgcatagaggacccaggcagtgctaagcagcgaccgcccaggagtacctgccagaccctc
gagtcaacagagcaaccaaatcacgaggacccacaacctcatccttctgcgggggccccc
atccctggggtggaagacattattgaatcttcaatgggcactaactgggtcttagaagaa
gcttctggagaggctagtgagggatttttgacccaggaaaggaagttttccccctccaat
cctgtagggggcagcatccaggcagagactgacagaccctgggcccgctcagcatcttct
ccattccctaaattaacagaggatcaacagccaacgaatataacagacaccccgttgaca
gaggtgaaccctatgagacccactggccagacactgaataatactcctgagaagacggat
ggttcatctacactgcgcgaagaccagcaggagccacgctctccccattttgccacactg
aatccccaacgagtcggcaactcagccaccccctatgctaagttactgcctcccaaaagc
cactcttggggcattgtactgccccttggggagctcgagggcaagaaaagtactagagat
cgaaggagccccgcagagctgaaaggaggaccagcaagtgagggggcagccaggcctgtg
gcccaaagtactagagatcgaaggagccccgcagagctgaaaggaggaccagcaagtgag
ggggcagccaggcctgtggcccgttttaattccattcctttgaccgacacaggctcttct
attcaggatccccagacctctgcgtttgtcttctgggtgctaggcatcatcctagtcttg
ctggctgtcgggggcctcctgttctacagttggaagcggaggagccatcgagaccctcgg
acattggattcttctgtggggcgaccagagggcagctccctggcccaggatgaggacaga
caggtggaactgccagtgtag

DBGET integrated database retrieval system