KEGG   Rattus norvegicus (rat): 78968Help
Entry
78968             CDS       T01003                                 

Gene name
Srebf1, ADD-1, ADD1, SREBP-1, SREBP-1c, Srebp1
Definition
(RefSeq) sterol regulatory element binding transcription factor 1
  KO
K07197  sterol regulatory element-binding transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    78968 (Srebf1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    78968 (Srebf1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    78968 (Srebf1)
   04931 Insulin resistance
    78968 (Srebf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    78968 (Srebf1)
   04131 Membrane trafficking [BR:rno04131]
    78968 (Srebf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    78968 (Srebf1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    78968 (Srebf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 78968
NCBI-ProteinID: NP_001263636
RGD: 69423
Ensembl: ENSRNOG00000003463
UniProt: P56720
Position
10q22
AA seq 1134 aa AA seqDB search
MDELPFGEAALEQALAEVCEMDAALLTDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG
PSSPGASSPESFSSPASLGSSLEAFLGGPKVTPAPLSPPPSAPTAVKMYPSVPPFSPGPG
IKEEPVPLTILQPPAPQPSPGTLLPPSFPPPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQ
TPSSLPLGSTPGISPTPLHTQVQSSAAQQPPPASAAPRMSTVASQIQQVPVVLQPHFIKA
DSLLLTAVKTDTGATMKTAGINTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH
RLAAGGKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA
IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP
PPSDAGSPSQSSPLSLGSRGSSSGGSDSEPDSPAFEDNQVKAQRLPSHSRGMLDRSRLAL
CVLVFLCLTCNPLASLFGWGILTPSDASGVHRSSGRSMLEAESRDGSNWTQWLLPPLVWL
ANGLLVLACLALLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGDFAQAAQQLWLALQA
LGRPLPTSNLDLACSLLWNLVRHLLQRLWVGRWLAGQAGGLQRDYRLRKDARASARDAAV
VYHKLHQLHAMGKYTGGHLVASNLALSALNLAECAGDAISMATLAEIYVAAALRVKTSLP
RALHFLTRFFLSSARQACLAQSGAVPLAMQWLCHPVGHRFFVDGDWAVHGAPQESLYSVA
GNPVDPLAQVTRLFCEHLLERALNCIAQPSPGAADGDREFSDALGYLQLLNSCSDAVGAP
ACSFSVSSSMATTTGTDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVEHIPQVLQETER
PLPRAALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTSTASSIDKAMQLLL
CDLLLVARTSLWRRQQSAASAQGAHGTSNGPQASALELRGFQHDLSSLRRLAQSFRPAMR
RVFLHEATARLMAGASPARTHQLLDRSLRRRAGSSGKGGAAAELEPRPTWREHTEALLLA
SCYLPPAFLSAPGQRVSMLAEAARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
atggacgagctacccttcggtgaggcggctctggaacaggcactggccgaggtgtgcgaa
atggacgcggcgctcttgaccgacatcgaagacatgcttcagctcatcaacaaccaagac
agtgacttccctggcctatttgatgccccctatgctgggggtgagacaggagacacaggc
cccagcagccctggtgccagctctcctgagagcttctcttctcctgcttctctgggctcc
tctctggaagccttcctgggaggacccaaggtgacacctgcacccttgtcccctccacca
tcggcacccactgctgtaaagatgtacccgtccgtgccccccttctcccctgggcctgga
atcaaagaggagccagtgccactcaccatcctgcagcccccagcaccacagccatcgcca
gggaccctgttgcctccgagcttccctcctccacctgtgcagctcagccctgctcctgtg
ctggggtactcaagcctgccttccggcttctcaggaacccttcctgggaacacccagcag
acgccatctagcctgccactgggctccacgccaggaatctcgcccacccccttacacacc
caggtccagagctcggccgcccagcagccgccgccagcctcagcagcccctagaatgagc
actgtggcctcacagatccagcaggtccccgttgtactgcagccacacttcatcaaggca
gactcgctgctgctgacagctgtaaagacagacacaggagccacaatgaagaccgcaggc
atcaacaccctggctcctggcacagccgtgcaggcaggccccttgcagaccctggtgagt
ggagggaccatcctggccacagtaccactggttgtggacacagacaaactgcccatccac
cgactagcagctggtggcaaggccctgggctcagctcagagccgtggtgagaagcgcaca
gcccacaatgccattgagaagcgctaccgttcctctatcaatgacaagattgtggagctc
aaggacctggtggtgggcactgaggcaaagctgaataaatctgctgtcttgcgcaaggcc
atcgactacatccgcttcttacagcacagcaaccagaaactcaagcaggagaacctgacc
ctgcgaagtgctcacaaaagcaaatcactgaaagacctggtgtcagcttgtggcagtgga
ggaggcacagatgtgtctatggagggcatgaaacctgaagtggtagaaacgctgacccct
ccaccctcagacgccggctcaccctcccagagtagccccttgtccttgggcagcagaggc
agcagcagtggtggcagtgactctgagcccgacagcccagcctttgaggataaccaggtg
aaagcccagcggctgccttcacatagccgaggcatgctggaccgctcccgcctggccctg
tgtgtactggtcttcctgtgtctgacctgcaacccattggcctcactgtttggctggggc
atcctcactccctctgatgcttcgggtgtgcaccgtagttctgggcgcagcatgctggag
gccgagagcagagatggctctaattggacccagtggttgctgccacccctagtctggctg
gccaatggactactagtgttggcctgcttggctcttctctttgtctacggggaacctgtg
accaggccacactccggcccggctgtacacttctggagacatcgcaaacaagctgacctg
gatttggcccggggagattttgcccaggccgctcaacagctgtggctggccttgcaagcc
ctgggccggcccctgcccacctcaaacctggatctggcctgcagcctgctttggaacctc
gtccgccacctgctgcagcgtctttgggtgggccgctggctggcaggccaggctgggggc
ctgcagagggactacaggctgagaaaggatgctcgtgccagtgcccgagatgcggctgtc
gtctaccataagctgcaccagctgcatgccatgggcaagtacacaggaggccatcttgtt
gcttctaacctggcactgagtgcccttaacctggctgagtgtgcaggagatgctatatcc
atggcaacactggcagagatctacgtggcagctgccctaagggtcaaaaccagcctcccc
agagccttgcacttcttgacacgtttcttcctgagtagtgcccgccaggcctgcctggca
cagagtggtgcagtgcctcttgccatgcagtggctctgccaccctgtaggtcaccgtttc
ttcgtggatggggactgggctgtacacggtgccccccaggagagtctgtacagcgtggct
gggaacccagtggatccactggcccaggtgacccgactattctgtgaacatctcctggag
cgagcattgaactgtatcgctcagcccagcccaggggcagctgatggagacagggagttc
tcagatgctcttggatatctacagttgctaaatagctgttctgacgctgtcggagctcct
gcgtgcagcttctctgtcagttccagcatggctaccaccactggcacagacccagtggcc
aagtggtgggcctcactgacagccgtggtgatccactggctgaggcgggatgaggaggca
gctgaacgcttatacccactggtagagcacattccccaagtgctgcaggaaactgagaga
ccccttcccagggcagctctgtactccttcaaggctgcccgggctctgctggaccacaga
aaggtggaatccagcccagccagcctggccatctgtgagaaggccagtgggtacctgcgg
gacagcttagcctctacatcaactgccagttccattgacaaggccatgcagctgctcctg
tgtgatctacttcttgtggcccgcaccagcctatggcggcgccaacagtcagcagcttca
gcccagggagctcacggtaccagcaatggaccccaggcctctgctctggagctgcgtggt
ttccaacatgacctgagcagcctgaggcgcttggcacagagcttccggcctgctatgagg
agggtcttcctacatgaggccacagctcggctgatggcaggagcaagtcctgcccggaca
caccagctcctggaccgcagtctgcggaggcgggcaggttccagtggcaaaggaggcgct
gcagctgagctggagcctcgacccacatggcgggagcacacagaggccttgctgttggcc
tcctgctatctgccccctgccttcctgtcggcccccgggcagcgagtgagcatgctggct
gaggcagcgcgcaccgtggagaagcttggcgatcaccggctcctgcttgactgccagcag
atgctcctgcgcctgggtggcgggaccactgtcacttccagctag

DBGET integrated database retrieval system