KEGG   Rattus norvegicus (rat): 78975Help
Entry
78975             CDS       T01003                                 

Gene name
Prkaa2, Ampk, Ampka2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    78975 (Prkaa2)
   04068 FoxO signaling pathway
    78975 (Prkaa2)
   04151 PI3K-Akt signaling pathway
    78975 (Prkaa2)
   04152 AMPK signaling pathway
    78975 (Prkaa2)
   04150 mTOR signaling pathway
    78975 (Prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    78975 (Prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    78975 (Prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    78975 (Prkaa2)
   04922 Glucagon signaling pathway
    78975 (Prkaa2)
   04920 Adipocytokine signaling pathway
    78975 (Prkaa2)
   04921 Oxytocin signaling pathway
    78975 (Prkaa2)
  09149 Aging
   04211 Longevity regulating pathway
    78975 (Prkaa2)
   04213 Longevity regulating pathway - multiple species
    78975 (Prkaa2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    78975 (Prkaa2)
   04714 Thermogenesis
    78975 (Prkaa2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    78975 (Prkaa2)
   05410 Hypertrophic cardiomyopathy (HCM)
    78975 (Prkaa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    78975 (Prkaa2)
   04931 Insulin resistance
    78975 (Prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    78975 (Prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    78975 (Prkaa2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    78975 (Prkaa2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     78975 (Prkaa2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   78975 (Prkaa2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    78975 (Prkaa2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    78975 (Prkaa2)
  Mitophagy factors
   Other mitophagy factors
    78975 (Prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 78975
NCBI-ProteinID: NP_076481
RGD: 620893
Ensembl: ENSRNOG00000007706
UniProt: Q09137
Position
5q34
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
IATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDMAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSVDSSTAENHSLSGSLTGSLTGSTLSSASPRLGSHTMDFF
EMCASLITALAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgtgtgaagatcggacactacgtgctgggggac
accctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattgacaggccat
aaagtggcagttaagatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatcttaaactctttcgtcatcctcatattatcaaactctac
caagtgatcagcactccaacagacttttttatggtaatggaatatgtgtctggaggtgaa
ttgttcgactacatctgtaaacacgggagggttgaagaggtggaagctcgccggctcttc
cagcagattctgtctgccgtggactactgtcacaggcacatggttgtccacagggacctg
aagccagagaacgtgttgctggacgcccagatgaatgctaagatagctgacttcggactc
tctaatatgatgtcagatggtgaatttctacgaactagctgtggatcgccaaattatgca
gcaccggaggtcatctcaggaaggctgtatgcgggtcctgaggttgatatctggagctgt
ggtgttatcctgtatgcccttctctgtggcaccctcccgttcgacgatgagcacgtgcct
acgctctttaagaagatccgagggggtgtgttctacatcccggagtatctcaaccgttct
attgccactctgctgatgcacatgctgcaggtggaccccttgaagcgagcaactatcaaa
gacatacgagagcatgaatggtttaaacaggatttgcccagttacctctttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtatgtgaaaaattt
gagtgtacagaatcagaagtgatgaacagtttatacagtggtgaccctcaagaccagctc
gcagtggcttatcatctcatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctccagtcctccaacgggttccttcatggacgatatggccatgcacattccc
cccggcctgaaaccacatcctgaaaggatgccacctctcatagcagacagccccaaagca
cgctgtccactggatgcactcaacacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcaccttgggatccgaagccagagcaaaccatacgacattatggcggaggtgtac
cgagctatgaagcagctggactttgaatggaaggtagtgaatgcataccatcttcgagta
agaagaaaaaacccagtgactggcaattacgtgaaaatgagcttacagctttacctggtt
gacaatcggagctatcttctagactttaaaagcatcgatgatgaggtggtggagcagagg
tctggttcttcaacacctcagcgctcctgttctgctgccggcctccacagacctcggtca
agtgtcgattccagcacagccgagaaccattcactgtctggctctctcactggttctttg
actggcagcactttgtcctccgcttccccgcgcctgggcagtcataccatggattttttt
gaaatgtgcgccagtcttatcactgctttagcccgttga

DBGET integrated database retrieval system