KEGG   Rattus norvegicus (rat): 78976Help
Entry
78976             CDS       T01003                                 

Gene name
Kiss1r, Gpr54
Definition
(RefSeq) KISS1 receptor
  KO
K08374  KISS1 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    78976 (Kiss1r)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    78976 (Kiss1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    78976 (Kiss1r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Galanin
    78976 (Kiss1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 78976
NCBI-ProteinID: NP_076482
RGD: 70930
Ensembl: ENSRNOG00000011954
UniProt: Q924U1 A0A1W2Q6L7
Position
7q11
AA seq 396 aa AA seqDB search
MAAEATLGPNVSWWAPSNASGCPGCGVNASDGPGSAPRPLDAWLVPLFFAALMLLGLVGN
SLVIFVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPTWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALTVSLSIWVGSAAVSAPVLAL
HRLSPGPHTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAP
TDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYA
AYALKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCGPQRQRRPHASAHSDRAAPH
SVPHSRAAHPVRVRTPEPGNPVVRSPSVQDEHTAPL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagaggcgacgttgggtccgaacgtgagctggtgggctccgtccaacgcttcg
ggatgcccgggctgcggtgtcaatgcctcggatggcccaggctccgcgccaaggcccctg
gatgcctggctggtgcccctgtttttcgctgccctaatgttgctggggctagtcgggaac
tcactggtcatcttcgttatctgccgccacaagcacatgcagaccgtcaccaatttctac
atcgctaacctggcggccacagatgtcactttccttctgtgctgcgtacccttcaccgcg
ctcctctatccgctgcccacctgggtgctgggagacttcatgtgcaaattcgtcaactac
atccagcaggtctcggtgcaagccacatgtgccactttgacagccatgagtgtggaccgc
tggtacgtgactgtgttcccgctgcgtgcacttcaccgccgcactccgcgcctggccctg
actgtcagccttagcatctgggtgggttccgcagctgtttccgccccggtgctggctctg
catcgcctgtcgcccgggcctcacacctactgcagtgaggcgtttcccagccgtgccctg
gagcgcgctttcgcgctctacaacctgctggccctatacctgctgccgctgctcgccacc
tgcgcctgctacggtgccatgctgcgccacctgggccgcgccgctgtacgccccgcaccc
actgatggcgccctgcaggggcagctgctagcacagcgcgctggagcagtgcgcaccaag
gtctcccggctggtggccgctgtcgtcctgctcttcgccgcctgctggggcccgatccag
ctgttcctggtgcttcaagccctgggcccctcgggggcctggcaccctcgaagctatgcc
gcctacgcgctcaagatctgggctcactgcatgtcctacagcaattctgcgctcaacccg
ctgctctatgccttcctgggttcccacttcagacaggccttctgccgcgtgtgcccctgc
ggcccgcaacgccagcgtcggccccacgcgtcagcgcactcggaccgagccgcaccccat
agtgtgccgcacagccgggctgcgcaccctgtccgggtcagaacccccgagcctgggaac
cctgtggtgcgctcgccctctgttcaggatgaacacactgccccactctga

DBGET integrated database retrieval system