KEGG   Rattus norvegicus (rat): 79114Help
Entry
79114             CDS       T01003                                 

Gene name
Fgfr1
Definition
(RefSeq) Fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04714  Thermogenesis
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05215  Prostate cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    79114 (Fgfr1)
   04015 Rap1 signaling pathway
    79114 (Fgfr1)
   04010 MAPK signaling pathway
    79114 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    79114 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    79114 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    79114 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79114 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    79114 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    79114 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    79114 (Fgfr1)
   05205 Proteoglycans in cancer
    79114 (Fgfr1)
   05230 Central carbon metabolism in cancer
    79114 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    79114 (Fgfr1)
   05215 Prostate cancer
    79114 (Fgfr1)
   05224 Breast cancer
    79114 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    79114 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    79114 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    79114 (Fgfr1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     79114 (Fgfr1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   79114 (Fgfr1)
CD molecules [BR:rno04090]
 Proteins
  79114 (Fgfr1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   79114 (Fgfr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 Ig_4 C2-set_2 Ig_6 Pkinase_fungal DUF4611 Kinase-like DUF1615
Motif
Other DBs
NCBI-GeneID: 79114
NCBI-ProteinID: NP_077060
RGD: 620713
Ensembl: ENSRNOG00000016050
UniProt: Q04589
Position
16q12.4
AA seq 822 aa AA seqDB search
MWGWRGLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVRDSIPADSGLYACVTNSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPSPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYDQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPNPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWNAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQDSPSF
PDTRSSTCSSGEDSVFSHEPFPEEPCLPRHPTQLANGGLNRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggggctggaggggcctcctcttctgggctgtgctggtcacagccactctctgcact
gccagaccagccccaaccttgcccgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggtgacctgctacagcttcgctgccggctgcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggcggaaagcaaccgtacacgc
atcacaggggaggaggtggaggtgcgggattccatccccgctgactctggcctctacgct
tgtgtgaccaacagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactgccatcctcggaggacgatgacgatgatgatgactcctcctcagaggagaaagag
acagacaacaccaaaccaaaccgtaggcctgtggcgccatactggacatccccagagaaa
atggagaagaaactgcacgcagtgccagctgccaagacggtgaaattcaaatgcccgtcg
agtgggacacccagccccactttgcgctggttgaaaaacggcaaggaattcaaacctgac
caccggatcggaggctacaaggttcgttacgccacttggagcatcataatggactctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaacgagtatgggagcattaac
cacacctaccagctagacgttgtggagcgatcccctcaccggcccatccttcaggcaggg
ctaccagccaacaagaccgtggccctgggcagcaacgtggagttcatgtgcaaggtgtac
agtgacccccagcctcacatccagtggctgaagcacatcgaggtgaatgggagtaagatc
ggtccagacaacttgccgtatgaccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagccgtgatgacctcacctctgtacctggaaatcattatctac
tgcaccggggccttcctgatctcctgtatggtgggctccgtcatcatctacaagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcataagctggctaagagc
atccctctccgcagacaggtaacagtgtcagctgactccagcgcatccatgaactccggg
gttctcctggttcggccttcgcgactgtcctccagcggaacccccatgctagctggcgtc
tctgaatatgagctccctgaagatccccgctgggagctgccccgggacagactggtctta
ggaaaaccgcttggcgagggctgcttcgggcaggtggtgttggccgaagccatcggtctg
gataaggacaaacccaaccgcgtgaccaaagtggccgtgaagatgttgaagtctgatgcg
acggagaaggacctgtcggacctgatctcggagatggagatgatgaaaatgatcgggaag
cacaagaatatcatcaacctgctgggggcgtgcacacaggatggtcctctctatgtcatt
gtggagtatgcctccaaaggcaatcttcgggagtatctgcaggcccggaggcctcctggg
ctggagtattgctacaaccccagccacaaccctgaggaacagctgtcttccaaagatctg
gtgtcctgtgcctatcaggtggcccggggcatggagtatcttgcctcgaagaagtgtata
caccgagacctggctgctaggaatgtcctggtgacagaggataatgtcatgaagatcgca
gactttggcctagctcgagacattcaccatatcgactactataagaaaaccaccaatggc
cggctgcctgtgaagtggatggcacctgaggcattgtttgaccggatctacacccaccag
agtgatgtgtggtcttttggggtgctcttatgggagatattcactctgggtggctcacca
aaccccggcgtgcctgtggaagaacttttcaagctgttgaaggagggtcatcgaatggac
aagcccagtaactgtaccaatgagctgtacatgatgatgcgggactgctggaacgcagtg
ccctctcagagaccaactttcaagcagttggtggaagacctggaccggattgtggccttg
acctccaaccaggagtatctggacctgtccatgccactggaccaggactcgccaagcttt
ccggacacacggagctctacctgctcttcaggggaggactctgtcttctctcatgagcca
tttcctgaggagccctgtctgccccgacaccccacccagcttgcaaatggcggactcaac
cggcgctga

DBGET integrated database retrieval system