KEGG   Rattus norvegicus (rat): 79119Help
Entry
79119             CDS       T01003                                 

Gene name
Arf2
Definition
(RefSeq) ADP-ribosylation factor 2
  KO
K06883  uncharacterized protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    79119 (Arf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 79119
NCBI-ProteinID: NP_077064
RGD: 621271
Ensembl: ENSRNOG00000004807
UniProt: P84082
Position
10q32.1
AA seq 181 aa AA seqDB search
MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAV
LLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgtttttgaaaagctgtttaaaagcctatttgggaaaaaggaaatgcggatt
ctcatggtgggcttagatgcagctggcaaaacgacgatcttgtacaaactgaagctggga
gagattgtgacaaccatccccaccataggtttcaacgtggagaccgtagaatataaaaac
atcagcttcacagtctgggatgttggtggccaggacaaaatcagacctttgtggcgacat
tacttccagaacactcaaggtctgatattcgtggttgatagtaacgacagagagcgggtc
aatgaggcccgggaagaactgaccagaatgctagcagaagatgagctcagagacgcagtc
ttattggtgtttgtaaacaaacaggatcttcctaatgctatgaacgcagcagagatcaca
gacaagcttggcttacattcacttcgccagagaaactggtacattcaggctacctgtgcg
accagtggagatgggctttacgaaggcctggactggctctccaaccaactcaagaaccag
aagtga

DBGET integrated database retrieval system