KEGG   Rattus norvegicus (rat): 79120Help
Entry
79120             CDS       T01003                                 

Gene name
Arf4
Definition
(RefSeq) ADP-ribosylation factor 4
  KO
K07939  ADP-ribosylation factor 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    79120 (Arf4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    79120 (Arf4)
   04031 GTP-binding proteins [BR:rno04031]
    79120 (Arf4)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    79120 (Arf4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   79120 (Arf4)
  Exosomal proteins of other body fluids (saliva and urine)
   79120 (Arf4)
  Exosomal proteins of colorectal cancer cells
   79120 (Arf4)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    79120 (Arf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Motif
Other DBs
NCBI-GeneID: 79120
NCBI-ProteinID: NP_077065
RGD: 621275
Ensembl: ENSRNOG00000012623
UniProt: P61751
Position
16p16
AA seq 180 aa AA seqDB search
MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAV
LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaccatctcctctctcttctcgcgcctcttcggcaagaagcagatgcgcatt
ttgatggttggattggatgctgcgggcaagacgacgattctgtataaactgaaactaggg
gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac
atttgtttcacagtttgggatgttggtggtcaagataaaattaggcctctctggaggcat
tacttccagaatacccagggtctcattttcgtggtagatagcaatgatcgtgaaagaatt
caggaaggagcagccgtgctgcagaaaatgcttctggaagatgagctgcaggatgctgtg
ctgctgctttttgccaacaaacaggatttgccaaatgctatggccatcagtgagatgaca
gacaagttaggtcttcagtctctccggaacagaacatggtatgtccaagccacttgtgct
acacaaggaactggtctgtacgaggggctggattggctgtcaaatgaactttcaaaacgc
taa

DBGET integrated database retrieval system