KEGG   Rattus norvegicus (rat): 79124
Entry
79124             CDS       T01003                                 

Gene name
Anxa4, Anx4
Definition
(RefSeq) annexin A4
  KO
K17093  annexin A4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    79124 (Anxa4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    79124 (Anxa4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    79124 (Anxa4)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    79124 (Anxa4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   79124 (Anxa4)
  Exosomal proteins of other body fluids (saliva and urine)
   79124 (Anxa4)
  Exosomal proteins of colorectal cancer cells
   79124 (Anxa4)
  Exosomal proteins of bladder cancer cells
   79124 (Anxa4)
SSDB
Motif
Pfam: Annexin UBA_2
Other DBs
NCBI-GeneID: 79124
NCBI-ProteinID: NP_077069
RGD: 621171
Ensembl: ENSRNOG00000018159
UniProt: Q5U362
Structure
PDB: 
2ZHJ 2ZHI

Position
4q34
AA seq 319 aa
METKGGTVKAASGFNATEDAQVLRKAMKGLGTDEDAIIGVLACRNTAQRQEIRTAYKSTI
GRDLLEDLKSELSSNFEQVILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRNPEE
IRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVKQDAQDLYE
AGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIV
KCMRNKPAYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIK
GDTSGDYRKVLLILCGGDD
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaaaccaaaggaggaactgtgaaagctgcttcaggattcaatgcaactgaagatgcc
caggtcctgaggaaggccatgaaaggtctgggtactgacgaagatgccattatcggagtc
ttagcctgccggaacactgcccaacgccaggaaatcaggacggcctacaagagcaccatt
ggcagggacctgcttgaggacttgaagtcggagctgagcagcaacttcgagcaggtgatc
ctgggcatgatgacgcccacagtgctgtatgacgtgcaggagctccggagggctatgaag
ggagctggcacggacgagggctgtctgattgagatcctggcctctcgcaaccctgaggag
atccgtcgcatcaaccagacataccagcagcaatatggaaggagccttgaagaggacatc
tgctctgacacatccttcatgttccagcgagtactggtgtccctgacagcgggtggcagg
gatgaaggaaattacctcgatgatgcgctcgtgaagcaggatgcccaggatctgtatgag
gctggagagaagagatgggggacggatgaagtgaagttcctaagcattctctgttcccgg
aaccggaaccacctgctccatgtgtttgatgaatacaaacggatctcacagaaggacatt
gaacagagcattaagtctgagacatctggaagctttgaagatgctctgctggctatagtg
aagtgcatgaggaataaacctgcctattttgctgaaaggctttataaatccatgaagggc
ttaggcactgacgacagcaccctcatcagagtgatggtgtctcgagcagagattgacatg
ctggacatccgggcaaacttcaagaggctctacgggaagtctttgtactcttttatcaag
ggcgacacttctggagactacaggaaggttctgctcattctctgtggaggagatgattaa

DBGET integrated database retrieval system