KEGG   Rattus norvegicus (rat): 79126
Entry
79126             CDS       T01003                                 

Gene name
Cfi
Definition
(RefSeq) complement factor I precursor
  KO
K01333  complement factor I [EC:3.4.21.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    79126 (Cfi)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    79126 (Cfi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    79126 (Cfi)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    79126 (Cfi)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.45  complement factor I
     79126 (Cfi)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   79126 (Cfi)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   79126 (Cfi)
SSDB
Motif
Pfam: Trypsin Ldl_recept_a SRCR Kazal_2 Trypsin_2
Other DBs
NCBI-GeneID: 79126
NCBI-ProteinID: NP_077071
RGD: 620429
Ensembl: ENSRNOG00000053400
UniProt: Q9WUW3
Position
2
AA seq 604 aa
MKLALLILLLLNPHLSSSKNTPASGQPQEDLVEQKCLLKNYTHHSCDKVFCQPWQKCIEG
TCACKLPYQCPKAGTPVCATNGRGYPTYCHLKSFECLHPEIKFSNNGTCTAEEKFNVSLI
YGSTDTEGIVQVKLVDQDEKMFICKNSWSTVEANVACFDLGFPLGVRDIQGRFNIPVNHK
INSTECLHVRCQGVETSLAECTFTKKSSKAPHGLAGVVCYTQDADFPTSQSFQCVNGKRI
PQEKACDGVNDCGDQSDELCCKGCRGQAFLCKSGVCIPNQRKCNGEVDCITGEDESGCEE
DKKNKIHKGLARSDQGGETEIETEETEMLTPDMDTERKRIKSLLPKLSCGVKRNTHIRRK
RVVGGKPAEMGDYPWQVAIKDGDRITCGGIYIGGCWILTAAHCVRPSRYRNYQVWTSLLD
WLKPNSQLAVQGVSRVVVHEKYNGATYQNDIALVEMKKHPGKKECELINSVPACVPWSPY
LFQPNDRCIISGWGREKDNQKVYSLRWGEVDLIGNCSRFYPGRYYEKEMQCAGTSDGSID
ACKGDSGGPLVCKDVNNVTYVWGIVSWGENCGKPEFPGVYTRVASYFDWISYYVGRPLVS
QYNV
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaagctcgctctgcttattctgctactcttgaatcctcacttgagttcttccaagaac
acaccagcctcaggtcagcctcaggaggatctggtagagcagaaatgcttactgaaaaac
tacacgcatcactcctgtgacaaagtcttctgccagccatggcagaaatgtatcgaggga
acctgtgcctgcaaactcccttaccagtgcccaaaggccgggaccccggtgtgcgccact
aatggaagaggctacccgacatactgtcacctgaagagtttcgaatgtcttcacccggag
ataaagttctcgaataatggaacatgcacagctgaagaaaagtttaatgtttccttaatt
tatggaagcacagatacagagggaattgttcaagttaaactcgtggaccaagatgagaaa
atgttcatatgtaaaaatagctggagcaccgtggaagccaacgtggcctgcttcgacctc
ggatttccactgggtgttcgtgacatacaaggaaggtttaatatacctgtaaatcacaaa
ataaactccaccgaatgcctgcatgtgcgttgccagggagtagagaccagtttggcagag
tgtacctttaccaagaagagttcgaaggctccccatggcttggcaggtgtagtgtgctac
acacaggatgcagatttcccaacaagtcagtccttccagtgtgtgaatgggaagcgcatt
cctcaggagaaagcctgtgatggtgtcaacgactgtggagatcaaagtgatgagctgtgt
tgcaaaggttgccgaggccaagccttcctttgcaagtcgggagtttgcatcccaaaccaa
cgtaagtgtaacggtgaggtggactgcatcaccggcgaggacgagagtggctgtgaagaa
gacaaaaagaataaaattcataaaggccttgcacggtcagaccaaggaggagaaactgaa
attgagactgaagaaacagaaatgttgactcctgatatggacacagaaagaaaacggata
aagtccttattacctaaactatcctgtggagtcaaaagaaatactcacattcgcaggaaa
agagtggtcggagggaagccagccgagatgggagattacccatggcaggtggcgattaag
gatggagatagaataacctgtgggggcatttatatcggtggctgttggattctgacagct
gcacactgtgtcagacccagtagatatcgcaactaccaagtatggacgtctttattagac
tggctaaagcctaactctcagttggcagttcagggagtgagcagagttgtcgttcatgaa
aagtataacggagccacctaccagaatgacatagctttggttgaaatgaaaaaacacccg
ggcaagaaagaatgtgagctcatcaattctgtccctgcctgtgtcccatggtctccatat
ctattccaaccgaatgacagatgcatcatttctggatggggtcgagaaaaagataaccaa
aaagtctactcactcaggtggggcgaagtcgacctaataggcaactgctcgaggttttac
ccgggtcgctactatgaaaaagagatgcagtgtgcgggtaccagtgatgggtccattgat
gcctgcaaaggagactctggaggccccttggtctgcaaggatgtcaacaatgtcacttat
gtttggggcattgtgagctggggagaaaactgtgggaaaccagagttcccaggtgtttac
accagagtggccagctattttgattggattagctactacgtgggaagaccccttgtttct
caatacaatgtctga

DBGET integrated database retrieval system