KEGG   Rattus norvegicus (rat): 79127Help
Entry
79127             CDS       T01003                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    79127 (Dck)
   00240 Pyrimidine metabolism
    79127 (Dck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     79127 (Dck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK Thymidylate_kin AAA_28 AAA_18 CoaE
Motif
Other DBs
NCBI-GeneID: 79127
NCBI-ProteinID: NP_077072
RGD: 620667
Ensembl: ENSRNOG00000003296
UniProt: P48769
Position
14p22
AA seq 260 aa AA seqDB search
MATPPKRFCSSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFIFQSYACLSRIRAQLASLNGSLRDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRA
TPEKCLNRIYIRGRDEEQGIPLEYLEKLHYKHESWLLHRTLKTNFEYLQEVPILTLDVNL
DFKDKEESLVEKVKEFLSTT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccacctaagaggttctgctcttctccctcaaccagctctgaggggacccgc
atcaagaagatctccatcgaagggaacatcgctgccgggaagtcaacgtttgtgaatatc
ttaaagcaagtctgtgaggattgggaagtggttcctgagcctgtggccaggtggtgcaat
gtgcagagtacccaagatgagtttgaggagttgacaacatctcagaagagtggtgggaat
gttcttcagatgatgtatgagaaacctgagcggtggtcttttatcttccaatcatacgcc
tgtctcagccggatccgggcccagcttgcctctctcaacggcagcctcagggatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatattttcgcatctaat
ttgtatgaatctgactgcatgaatgaaacagaatggacaatatatcaagactggcatgac
tggatgaatagccagtttggccaaagccttgaattggatggaataatttatcttcgagct
actccagagaagtgcttaaatagaatatatatacggggaagggatgaagagcaaggcatt
cctcttgaatatttagagaaacttcactataaacacgaaagctggctccttcatcggact
ctgaaaaccaactttgaatatctccaagaggtgcctatcctcacattggatgttaattta
gactttaaagacaaagaagaaagtctggttgaaaaggtcaaagagtttttgagtactact
tga

DBGET integrated database retrieval system