KEGG   Rattus norvegicus (rat): 79128
Entry
79128             CDS       T01003                                 

Gene name
Dab2, Doc-2, Doc2
Definition
(RefSeq) DAB2, clathrin adaptor protein
  KO
K12475  disabled homolog 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    79128 (Dab2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    79128 (Dab2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    79128 (Dab2)
SSDB
Motif
Pfam: PID DUF2406
Other DBs
NCBI-GeneID: 79128
NCBI-ProteinID: NP_077073
RGD: 621007
Ensembl: ENSRNOG00000028930
UniProt: O88797
Structure
PDB: 
3H8D

Position
2q16
AA seq 768 aa
MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNNPTESRDILLVDLN
SEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPESAFSANLNFFPTPNPDPFRDDPF
AQPDQSAPSSFHSLTSADQKKANPGSLSTPQSKGPLNGDTDYFGQQFDQISNRTGKQEAQ
GGPWPYPSSQTQQAVRTQNGVSEKEQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSV
QSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQANF
MDLFKTSAPAPMGSGPLVGLGTVPVTPPQAGPWTPVVFTPSTTVVPGAIISGQPSGFGQP
LVFGTTPAVQVWNQPSSFATAASPPPPAVWCPTTSVAPNTWSSTSPLGNPFQSSNIFPPS
TISTQSFPQPMMSSVLVTPPQPPPRNGPLKDTLSDAFTGLDPLGDKEVKEVKEMFKDFQL
RQPPLVPSRKGETPSSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPR
QGVLSGTKSADNSLENPFSKGFSSTNPSVVSQPASSDAHRSPFGNPFA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtctaacgaagtagaaacaagcacaaccaatggtcagcctgaccaacaggctgcaccg
aaagcaccatcaaagaaggaaaagaagaaaggttctgaaaagacagatgagtatctgttg
gccaggttcaaaggtgatggtgtaaaatacaaggccaagctaatcggtattgatgatgtg
cctgatgcgaggggagacaaaatgagtcaggattctatgatgaaactcaagggaatggca
gcagctggtcgctctcagggacagcacaagcaaaggatctgggtcaacatttccctgtct
ggcataaaaattattgatgagaaaaccggggtaatagagcatgaacatccagtaaataag
atttccttcattgctcgtgatgtgacagacaatagagcatttggttatgtgtgtggagga
gaaggccagcatcaattttttgctataaaaacagggcaacaggctgaaccattagtcgtc
gatcttaaagacctttttcaagttatctataatgtaaagaaaaaggaagaagaaaagaaa
aaggttgaagaagccaacaaagcggaagagaatgggagtgaggccctaatgacccttgat
gatcaagctaacaaactgaagctgggtgttgaccagatggatttgtttggggacatgtct
acacctcctgacctaaataatccaacagaaagcagagatatcctgttagtggatctaaac
tctgaaatcgacaccaatcagaactctttaagagaaaatccattcttaacaaatggagtc
acctcctgttctctccctcgaccaaagcctcaggcatccttcttgcctgaaagtgccttt
tctgccaatctcaacttctttcccacccctaatcctgatcctttccgtgatgatcctttc
gcacagccagaccaatcggcaccctcttcgtttcattctctcacatctgcagatcagaag
aaagcgaatccgggtagcttgtctactccacagagtaaagggcccttgaacggtgatact
gattactttggtcagcaatttgaccagatctctaaccggactggcaaacaggaagctcag
ggaggcccatggccctatccaagttcgcaaacccagcaagcagtgagaactcaaaatggg
gtatctgaaaaagaacagaacggcttccatatcaaatcttccccgaacccttttgtggga
agccctcccaaaggactatcggtaccgaatggcgtaaagcaggacttggaaagctctgtc
cagtcctcagcgcatgactccatagccattatcccacctccacaaagtaccaaaccagga
agaggcaggaggaccgctaagtcttcagcaaacgacctgcttgcttcagatatctttgcc
tcagaacctccaggccagatgtcccccacaggacaacctgcagtcccacaggcgaacttt
atggatctcttcaaaaccagtgctcctgccccaatggggtcggggcccctcgtaggtcta
ggtactgtcccagtaacacccccccaagcaggaccttggacacctgttgtcttcactcct
tctacaactgtggtcccaggagccataataagtggccagccttccggttttggtcagcca
ctcgtctttggtacaaccccagcagtgcaagtttggaatcagccttcatcatttgcaact
gcagcttcccctccacccccggcagtttggtgtcctaccacatctgtggcacccaacact
tggtcatccacaagtcccctggggaatccttttcagagtagtaatatctttccaccttcc
accatatccactcagtcctttcctcagcctatgatgtcctctgttctggtcacacctccc
caaccacctccccgaaatggcccactaaaggacactcttagtgatgccttcactggctta
gacccacttggggataaagaggtcaaggaagtgaaagaaatgtttaaggacttccagctg
cggcagccacctcttgtaccctcgaggaagggggagacaccttcctctgggacctcaagc
gccttctccagttacttcaacaataaagttggcattcctcaggagcatgtagaccatgat
gattttgatgccaatcaactgttgaacaagattaatgaaccaccaaagccagcccccaga
caaggtgtcctctcgggtaccaaatctgctgacaattcactcgagaaccctttctctaaa
gggttcagctcaacaaacccctccgtggtctctcagcctgcatcttctgatgcccacagg
agcccttttggaaatccttttgcctaa

DBGET integrated database retrieval system