KEGG   Rattus norvegicus (rat): 79131Help
Entry
79131             CDS       T01003                                 

Gene name
Fabp3
Definition
(RefSeq) fatty acid binding protein 3
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    79131 (Fabp3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   79131 (Fabp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7 TMEM223 VraX
Motif
Other DBs
NCBI-GeneID: 79131
NCBI-ProteinID: NP_077076
RGD: 69048
Ensembl: ENSRNOG00000012879
UniProt: P07483
Position
5q36
AA seq 133 aa AA seqDB search
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKN
TEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTH
GNVVSTRTYEKEA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcctttgtcggtacctggaagctagtggacagcaagaattttgatgactac
atgaagtcactcggtgtgggctttgccaccagacaggtggctagcatgaccaagccgacc
acaatcattgagaagaatggggataccatcaccataaagacacacagtaccttcaagaac
acagagatcagctttcagctgggagtagagtttgacgaggtcacagcagatgacaggaag
gtcaagtcggtcgtgacactggacggaggcaaactggtccatgtgcagaagtgggacggg
caggagactacgcttacacgggaactaagtgatgggaaactcatcctgactctcacccat
ggcaatgtggtgagcactcggacttacgagaaggaggcgtga

DBGET integrated database retrieval system