KEGG   Rattus norvegicus (rat): 79210
Entry
79210             CDS       T01003                                 

Gene name
Fstl1, Frp, Fstl
Definition
(RefSeq) follistatin-like 1
  KO
K23912  follistatin-related protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    79210 (Fstl1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    79210 (Fstl1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I1: Kazal family
   79210 (Fstl1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   79210 (Fstl1)
SSDB
Motif
Pfam: Kazal_2 Kazal_1 FOLN Pacifastin_I EF-hand_6 EF-hand_7 EF-hand_1
Other DBs
NCBI-GeneID: 79210
NCBI-ProteinID: NP_077345
RGD: 68955
Ensembl: ENSRNOG00000002746
UniProt: Q62632
Position
11q21
AA seq 306 aa
MWKRWLALALVTIALVHGEEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHK
RPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELR
RRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNIT
AYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYAD
GAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKK
VNTKEI
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtggaaacgctggctggcgctcgcgctggtgaccatcgccctggtccacggcgaggag
gaacaaagaagcaaatccaagatctgcgccaatgtgttttgtggagctggccgggaatgc
gccgtcacggagaagggggagccaacgtgcctctgcattgagcaatgcaaacctcacaag
aggcctgtgtgtggcagtaatggcaagacctacctcaaccattgtgaacttcacagagac
gcctgcctcactggatccaagatccaggttgattatgatgggcactgcaaagaaaagaag
tctgtgagtccatccgccagccccgttgtctgctatcaggctaaccgtgatgagctgcgg
cgccggatcatccagtggctggaagccgagatcattccagatggctggttctctaaaggc
agtaactacagtgagatcctagacaagtactttaagagctttgataatggtgactctcac
ctggactccagcgaattcctgaaattcgtggagcagaatgaaacagccgtcaacatcacc
gcttaccccaatcaggagaacaacaaactgctcagaggcctctgtgttgatgccctcatt
gaactgtccgatgagaacgctgactggaaactcagcttccaagagttcctcaagtgcctc
aacccatccttcaaccctcctgagaagaagtgcgccctggaggacgaaacctatgcagat
ggagctgagaccgaggtggactgcaatcgctgtgtctgttcctgtggacactgggtctgc
acagcgatgacctgtgatggaaagaatcagaagggggtccagacccacacagaggaggag
atgacgagatatgcccaggaactccagaagcaccagggaacagcagaaaagaccaagaag
gtgaacaccaaagagatctaa

DBGET integrated database retrieval system