KEGG   Rattus norvegicus (rat): 79216
Entry
79216             CDS       T01003                                 

Gene name
Gdf10
Definition
(RefSeq) growth differentiation factor 10
  KO
K22674  growth differentiation factor 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    79216 (Gdf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    79216 (Gdf10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   79216 (Gdf10)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 79216
NCBI-ProteinID: NP_077351
RGD: 621512
Ensembl: ENSRNOG00000051993
UniProt: P55108
Position
16p16
AA seq 476 aa
MAPGLARISLRSQLLPLVPLLLLLRGAGCGHRVPSWSSLPSAADSVQRDRDLQQSPGDAA
AALGPGAQDIVAVHMLRLYEKYNRRGAPPGGGNTVRSFRARLDVIDQKPVYFFNLTSMQD
SEMILTATFHFYSEPPRWPRAREVFCKPRAKNASCRLLTPGLPARLHLIFRSLSQNTATQ
GLLRGAMALTPPPRGLWQAKDISSIIKAARRDGELLLSAQLDSGEKDLGVPRPSSHMPYI
LVYANDLAISEPNSVAVTLQRYDPFPAGDFEPGAAPNSSADPRVRRAAQVSKPLQDNELP
GLDERPAPALHAQHFHKHEFWSSPFRALKPRTGRKDRKKKDQDTFTPSSSQVLDFDEKTM
QKARRRQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNH
ATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVETCACR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggctccaggtcttgctcggatcagcttgaggtctcagctgctgcccttggtgccgctg
ctcctgctactgcggggcgcaggctgcggccacagagtcccctcatggtcctcactgcct
tcagcagctgacagtgtgcagagggacagggacctccagcagtcacccggggacgctgca
gccgctctgggtccaggcgcccaggacatagtcgctgtccacatgctcaggctctatgag
aagtacaaccggagaggcgctccaccaggaggaggcaacaccgtccgaagcttccgtgcc
cggctggatgtgatcgaccagaagcctgtgtatttcttcaacttgacttccatgcaagac
tcagaaatgatcctcacagccaccttccacttctactcagaacctccacggtggccccgg
gctcgtgaggtattctgcaagccccgagctaagaatgcatcctgccggctcctgacccca
ggtctgcctgctcgcttgcacctaatcttccgcagtctctcgcagaacactgccactcag
gggctgctccgcggggccatggccctgacacctccaccacgtggcctctggcaggccaag
gacatctcctcaatcatcaaggctgcccgaagggatggagaacttcttctctctgctcag
ctggattctggagagaaggatctcggagtgccacggcccagttcccacatgccctatatc
cttgtctatgcaaatgacctggccatctcggagcccaacagtgtagcagtgacgctacag
agatacgacccatttccagctggagactttgagcctggagcagcccccaacagctcagcg
gatccccgcgtgcgcagggcggcacaggtatccaaacccctgcaagacaatgaacttcca
gggctggacgaaagaccagcgcctgccctgcacgcccagcatttccacaagcacgagttc
tggtccagtcctttccgggcactgaaaccccgcaccgggcgcaaagaccgcaagaagaaa
gaccaggatacattcaccccctcctcctcgcaggtgctggactttgatgagaagacgatg
cagaaagccaggaggcggcagtgggatgagcctcgggtctgctccaggaggtacctgaag
gtggattttgcagacatcgggtggaatgaatggatcatctcacccaaatcctttgatgcc
tactactgtgctggagcctgcgagttccccatgcccaagatcgtccgcccgtccaaccat
gccaccatccagagcatcgtcagagctgtgggcattgtccctggcatcccggagccatgc
tgtgtcccagacaagatgaactcccttggagtccttttcctggacgagaatcggaatgtg
gttctgaaggtgtaccccaatatgtccgtagagacctgtgcctgtcggtaa

DBGET integrated database retrieval system