KEGG   Rattus norvegicus (rat): 79220
Entry
79220             CDS       T01003                                 

Gene name
Grid2, GluD2
Definition
(RefSeq) glutamate ionotropic receptor delta type subunit 2
  KO
K05207  glutamate receptor delta-2 subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    79220 (Grid2)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    79220 (Grid2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    79220 (Grid2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   79220 (Grid2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 ApeA_NTD1 Desmo_N RNase_H
Other DBs
NCBI-GeneID: 79220
NCBI-ProteinID: NP_077355
RGD: 68368
Ensembl: ENSRNOG00000006174
UniProt: Q63226
Structure
PDB: 
2V3U 5CC2 2V3T 5L2E

Position
4q31
AA seq 1007 aa
MEVFPLLFFLSFWWSRTWDLATSDSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLNEVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFISEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLQDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVNGLTGDLEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPY
RDVFSQRILELQQSGDMDILKHKWWPKNGQCDLYSSVDAKQKGGALDIKSLAGVFCILAA
GIVLSCLIAVLETWWSRRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAAFGFTFGSVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggaagttttccccttgctcttctttctatccttctggtggtctcgaacctgggacctg
gcgacctccgattccatcatccacatcggagcaatttttgatgaatctgctaaaaaagat
gatgaagtattccgcacagcagttggtgacctcaaccagaatgaggaaatcttacagact
gagaaaatcacattttcagtgacatttgtggatggcaacaacccttttcaagctgttcaa
gaagcatgtgaacttatgaaccagggcatcttggccttggtcagctccattggttgcaca
tctgctgggtccctccagtctttggcagacgccatgcatatccctcacctcttcattcag
cgttcaacagctgggaccccaagaagtggctgcggcctcaccaggagcaacagaaacgat
gactataccctttcagttcgtccacctgtctacttgaatgaagtcatcctaagagtagtc
acagagtatgcatggcagaaatttattatcttctatgatagtgaatatgatatccgtggc
atacaggaatttttggacaaagtttcccagcagggaatggatgttgcccttcaaaaggtg
gaaaacaacatcaataaaatgatcaccacgctctttgacaccatgaggatagaggagttg
aatcgctatcgagacactctcagaagagccatccttgttatgaaccccgccacagccaaa
tccttcataagtgaggtggtggagactaatctggttgcttttgactgtcactggatcatc
atcaatgaggaaataaatgatgtggatgttcaggaacttgtcagaaggtccattggaagg
ttaacaattattcggcagacatttccagtcccccagaatataagtcagcgctgtttccgt
ggcaaccatcgaatttcttcaacactgtgtgatcccaaggatcccttcgcacagaatatg
gagatttctaacctttacatctatgacacggtgcttctgcttgcaaacgcctttcataag
aagctgcaggaccggaagtggcacagcatggcgagcttgtcctgtatcaggaaaaactcc
aagccctggcagggagggcggtccatgctggagaccatcaagaagggtggagttaatgga
ttgactggagatctagaatttggagaaaatggaggtaaccccaatgtccacttcgaaatc
cttggaaccaactatggagaagaacttggcaggggtgtccgtaaacttgggtgctggaat
cctgtcacaggtctgaatggatcactgacagacaagaaactggagaataacatgcgaggt
gtggttctacgcgtggtgactgtattggaggagccttttgtaatggtctctgaaaatgtc
ttgggaaaaccgaagaaataccagggcttctccattgatgttttagatgccctatctaac
tatctgggttttaactatgaaatttatgttgcaccggaccacaaatatggaagcccacaa
gaagatgggacatggaatggactagtaggagaacttgtttttaagagagctgacatcggg
atttcagctttaaccatcactccagaccgggagaatgttgtggattttacaacacgctac
atggactactcagtaggggtcctactgcgaagggcagaaaaaacagtggatatgtttgcc
tgccttgcaccatttgatctatctctgtgggcctgcattgccggcacagtccttcttgtg
ggactcctggtctacctcttgaactggcttaatcccccacggttgcaaatgggatcaatg
acatctactacactctataactccatgtggtttgtgtacgggtcctttgtacagcaaggt
ggggaagtaccatacacaactttggcaacccgaatgatgatgggggcttggtggttattt
gctctgattgtcatctcatcttatacagcaaatcttgccgctttcctcactatcacccgc
attgagagctccatccagtctcttcaggatctgtccaagcaaacggatatcccttatggc
acagtcttggattccgcagtatatcagcatgttcgcatgaaggggctgaatccttttgag
agggacagcatgtattcccagatgtggaggatgatcaaccgaagcaatggctcagagaac
aatgttctggagtcccaagcaggcattcaaaaggtaaaatatggaaactatgcttttgta
tgggatgcagctgtgttggaatatgtggccatcaatgaccccgactgttccttctacact
gttggaaatactgttgctgaccgggggtatggcatcgcactgcagcatggcagtccctac
cgtgatgtcttttcacaaaggatcctggagctgcagcagagtggcgacatggacatcctc
aagcacaaatggtggcctaagaatggccagtgtgacctgtactcctcagtagatgcaaag
cagaagggaggagccctggacatcaagagtctggcaggcgtgttctgcatcctggccgcg
gggattgtactctcctgcctcatagccgtcctcgagacatggtggagtcggcggaagggc
tcccgagtcccatcgaaagaggatgacaaggaaattgacctggagcacctccatagacgt
gtaaatagcttgtgcacagatgacgacagcccccataaacagttttccacctcgtcaatt
gacttgacccctctggacattgacactttgccaacacgacaagccctggagcagatcagt
gatttcagaaacactcacatcaccaccaccaccttcatcccagagcagatccagactctt
agccgcacactctcagcaaaagctgcctttggcttcactttcggcagtgtgcccgagcac
cgaactggcccttttaggcacagggcccctaatgggggctttttcaggagtcctatcaaa
acaatgtcatctattccttatcagcctactcccactctggggctcaatctgggcaatgac
cccgaccgaggcacgtccatatga

DBGET integrated database retrieval system