KEGG   Rattus norvegicus (rat): 79222
Entry
79222             CDS       T01003                                 

Gene name
Gucy2e
Definition
(RefSeq) guanylate cyclase 2E
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04740  Olfactory transduction
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    79222 (Gucy2e)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    79222 (Gucy2e)
   04740 Olfactory transduction
    79222 (Gucy2e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    79222 (Gucy2e)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     79222 (Gucy2e)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   79222 (Gucy2e)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Kinase-like OapA
Other DBs
NCBI-GeneID: 79222
NCBI-ProteinID: NP_077356
RGD: 620438
Ensembl: ENSRNOG00000007931
UniProt: P51840
Position
10q24
AA seq 1108 aa
MSAWLLPAGGFPGAGFCIPAWQSRSSLSRVLRWPGPGLPGLLLLLLLPSPSAFSAVFKVG
VLGPWACDPIFARARPDLAARLATDRLNRDLALDGGPWFEVTLLPEPCLTPGSLGAVSSA
LTRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPAVTPAADALYVLLK
AFRWARVALITAPQDLWVEAGRALSTALRARGLPVALVTSMVPSDLSGAREALRRIRDGP
RVRVVIMVMHSVLLGGEEQRYLLEAAEELGLTDGSLVFLPFDTLHYALSPGPEALAAFVN
SSKLRRAHDAVLTLTRRCPPGGSVQDSLRRAQEHQELPLDLDLKQVSPLFGTIYDAVFLL
AGGVTRARAAVGGGWVSGASVARQMREAQVFGFCGILGRTEEPSFVLLDTDAAGERLFTT
HLLDPVLGSLRSAGTPVHFPRGAPAPGPDPSCWFDPDVICNGGVEPGLVFVGFLLVIVVG
LTGAFLAHYLRHRLLHMQMVSGPNKIILTLEDVTFLHPQGGSSRKVAQGSRSSLATRSTS
DIRSVPSQPQESTNIGLYEGDWVWLKKFPGEHHMAIRPATKMAFSKLRELRHENVALYLG
LFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQRDIKLDWMFKSSLLLDLIKGMRYL
HHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLRDP
ALERRGTLAGDVFSLGIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAP
MECIQLMAQCWAEHPELRPSMDLTFDLFKGINKGRKTNIIDSMLRMLEQYSSNLEDLIRE
RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSE
PIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDIL
SAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYR
IHVNMSTVRILRALDQGFQMECRGRTELKGKGVEDTYWLVGRVGFNKPIPKPPDLQPGAS
NHGISLQEIPPERRKKLEKARPGQFTGK
NT seq 3327 nt   +upstreamnt  +downstreamnt
atgagtgcgtggctcctgccagcgggagggtttcccggcgctgggttctgtatccctgcg
tggcagtcccggtccagcctctcgcgggtcctgcgctggccagggcctgggctgcccgga
ctcctgctcctgctgctgctcccatctccgtctgccttctccgctgtgttcaaagtgggg
gtgctgggcccctgggcttgcgaccccatctttgcacgggcccgaccggatctggctgcg
cgtctggccaccgaccgcctgaatcgtgaccttgccttagacggcggcccctggttcgag
gttacgctgctcccagagccctgcctgactccgggctcgctaggggctgtgtcctccgcg
ctgactcgagtctctggcttggtgggtccggtgaaccccgcggcctgccggccagccgag
ctattagcccaggaagctggagtagcgctggtgccctggggctgccctggcacgcgggcg
gcgggtactacagccccggcggtgacccccgctgcagatgccctgtatgtcctccttaaa
gcattccgctgggcccgcgtggccctgatcaccgcaccccaggacctgtgggtggaggcg
ggacgcgctctgtccacagcactcagggcccggggtttgccagttgccctagtgacctcc
atggtgccttcagacctgtctggagcccgagaggccctcagaaggatccgagacgggcct
agagttagagtggttatcatggtgatgcactcggtactgctgggcggcgaggagcagcgc
tacctactggaagctgcagaagagctgggtctgactgatggctccctggtcttcctgccc
tttgacacccttcactacgcgttgtctccaggcccggaggctctggctgcatttgtcaac
agctccaagctccgcagggctcacgatgcggtgctcacgctgacacgccgctgtcctcct
ggaggcagcgtgcaagacagcttgcgcagggcccaagaacaccaggagctgccccttgac
ctcgacctgaagcaggtctctccgctgtttggcaccatctatgatgctgtcttcctgttg
gctgggggcgtgacgagagcaagagcagcagtgggtggcggctgggtgtcaggtgcatct
gtggcccgccaaatgcgggaagctcaagtctttggcttttgcgggatcctgggaagaacc
gaagagccctcctttgtgctgctggacacagatgcggcaggagaacggctgttcacaaca
cacctgctggatcctgtcttaggctccctgcgttccgctgggacccccgtgcacttccct
agaggtgcacctgctccgggtcccgatccttcctgctggttcgatccagatgtgatctgc
aacggaggggtggagccaggcctggtctttgttggcttcctcctggtgatagtggtggga
ctgactggagccttcctggctcattacttgaggcacaggctgctacacatgcaaatggtc
tccggccccaataagatcatcctgaccttggaagatgttactttcctccacccacaaggg
ggcagctctcgaaaggtggcccagggaagtagatccagtctggctacccggagtacatca
gacattcgcagtgtccccagccagccccaagagagcaccaacattggcctctatgagggc
gactgggtttggctgaagaaatttccaggagaacaccacatggccatccggccggcgacc
aagatggccttctccaagctgcgggagctccgccatgagaatgtggctctctacctggga
ctcttcctggcgggtacagcagacagccctgccacccctggggagggaatcttggctgtg
gtctccgagcactgtgctcggggctccctccatgacctcctggcccagagagacataaag
ctggactggatgttcaagtcttccctcctgctggacctcataaagggaatgagatatctc
caccatcgtggtgtggcccacgggaggcttaagtcacggaattgcgtggtggacgggagg
ttcgtgctcaaggtgacagatcatggccacgggcgacttctggaagcgcagagggtttta
cccgaacctcccagtgcagaggatcagctatggacagccccagagctgcttcgggaccca
gctctagagagacggggaactctagctggtgacgtctttagcctgggcatcatcatgcag
gaggtcgtgtgccgcagcacaccttatgccatgctggagctaacgcccgaggaagtgata
cagagggtgcggagccctcccccactgtgccggcccttggtgtcaatggaccaggcacct
atggaatgcatccagctgatggctcaatgctgggcagagcatccagagcttcggccttcc
atggacctcacctttgacctgttcaagggcatcaacaagggccggaagacgaacatcatt
gactccatgcttcggatgctggagcagtactctagtaacctggaggacttgatccgagaa
cgcacagaggagttagagcaggagaagcagaagacagacaggctgctcacacagatgctc
cctccatctgtggctgaggccctgaaaatggggacatctgtggagcctgaatactttgaa
gaggtgacactctatttcagtgacattgtgggctttaccaccatttcagccatgagtgag
cccattgaggtggtcgacctgcttaatgacctctatacactctttgatgccatcatcggt
tcccacgatgtctataaggtggaaacaattggagatgcatacatggtggcctccgggctg
ccacagaggaacgggcagcggcatgctgcagagattgccaacatgtcactggacatcctc
agtgcagtcggctccttccgcatgcgccatatgccggaggtaccagtgcgcatccgcatt
ggtctgcactcgggcccgtgcgtggccggtgtggtgggcctcaccatgcctcggtactgc
ctgtttggggacacggtcaacactgcctcacgaatggagtccactggactgccttatcgc
atccatgtaaacatgagcactgttcggattcttcgggctctggaccaaggcttccagatg
gaatgccgaggccgcacagagctgaagggcaagggtgttgaggacacgtactggcttgtg
ggcagagtcggcttcaacaagcccattcccaaaccacctgacctgcaaccaggggccagc
aaccatggcatcagcctgcaggagattcccccagagagacgcaagaagctagagaaagcc
aggccaggccagtttactgggaagtga

DBGET integrated database retrieval system