KEGG   Rattus norvegicus (rat): 79224
Entry
79224             CDS       T01003                                 

Gene name
Serpind1
Definition
(RefSeq) heparin cofactor 2 precursor
  KO
K03912  heparin cofactor II
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    79224 (Serpind1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    79224 (Serpind1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    79224 (Serpind1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    79224 (Serpind1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   79224 (Serpind1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   79224 (Serpind1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   79224 (Serpind1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 79224
NCBI-ProteinID: NP_077358
RGD: 619854
Ensembl: ENSRNOG00000001865
UniProt: Q64268
Position
11
AA seq 479 aa
MKHPAYTLLLSLIMSMCAGSKGLAEQLTKENLTVSLLPPNFHKENTVTNDWIPEGEEDDD
YLDLEKLLSEDDDYIYVVDAVSPTDSESSAGNILQLFQGKSRIQRLNILNAKFAFNLYRV
LKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDFVNASSKYEVTTIHN
LFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPAFIS
KANSHILKLTKGLIKEALENTDSATQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREV
VKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVIPRKLSGMKTLEAQLTPQVVER
WQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGISDQRIIIDLFKHQ
STITVNEEGTQAAAVTTVGFMPLSTQVRFTVDRPFLFLVYEHRTSCLLFMGRVANPAKS
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaagcatccagcctacactctccttctctctctcatcatgtctatgtgtgctgggagc
aaaggccttgctgagcagctaactaaggaaaacctgaccgtgtccctcctgcctcctaac
ttccacaaagagaacacagtcaccaatgactggattccagaaggagaggaagatgacgac
tacctggacctggagaagctgctcagtgaagatgacgactacatctatgttgtcgatgca
gtttccccaacagactcagaatcaagtgctggcaacatcctgcagcttttccaaggcaaa
agccggatccagcgccttaacatcctcaatgcaaagtttgccttcaacctttaccgagtc
ctgaaggaccaggctacctcttctgataacattttcatagcacccgttggcatttccact
gccatggggatgatctccttaggtttgaggggagagacccatgaggaagtacactcagtt
ctacacttcaaagactttgtcaatgctagcagcaagtacgaggtgacaaccattcacaac
ctctttcgaaagctgacccatcgcctattcagaaggaattttgggtacacacttcagtca
gttaatgacctttatattcagaagcagtttcccatacgggaggacttcaaagctgccatg
agagagttttactttgctgaggcccaggaggctgacttctcagatcctgccttcatatca
aaggcaaacagccacattctgaagctcaccaagggcctcataaaagaagctttggagaat
acagactctgctactcagatgatgattctgaactgcatctacttcaaaggagcttggatg
aataaattcccagtagaaatgacgcataaccacaacttccggctgaatgagagagaagta
gtaaaagtctccatgatgcaaactaaagggaacttccttgcggcaaatgaccaggagcta
gactgtgacattctgcagctggagtatgtagggggcatcagcatgctaattgtaattcca
cggaagctgtcgggaatgaagactcttgaagcacagcttacaccccaggtagtggagaga
tggcaaaaaagcatgacaaacagaacccgagaggtacttctgcccaagtttaagcttgag
aagaattacaacctggtggaggtcctcaagtccatgggaatcacaaagctcttcaacaag
aatggcaatatgtcaggcatctcagaccagaggatcatcattgatctgttcaagcaccag
agtaccatcacagtgaatgaagagggtacccaagctgcagctgtaactacagtggggttt
atgccgctgtctacccaagtcagattcactgttgaccgtcccttcctgttcctagtgtat
gagcaccgaaccagctgtctgctgttcatgggaagagtggccaaccctgccaagtcttaa

DBGET integrated database retrieval system