KEGG   Rattus norvegicus (rat): 79225
Entry
79225             CDS       T01003                                 

Gene name
Hes5
Definition
(RefSeq) hes family bHLH transcription factor 5
  KO
K06055  hairy and enhancer of split 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    79225 (Hes5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    79225 (Hes5)
  09162 Cancer: specific types
   05224 Breast cancer
    79225 (Hes5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    79225 (Hes5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79225 (Hes5)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    79225 (Hes5)
SSDB
Motif
Pfam: HLH Hairy_orange FancD2
Other DBs
NCBI-GeneID: 79225
NCBI-ProteinID: NP_077359
RGD: 621340
Ensembl: ENSRNOG00000013850
UniProt: Q03062
Position
5q36
AA seq 166 aa
MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRPW
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccccaagtaccgtggcggtggagatgctcagtcccaaggagaaaaatcgactgcgg
aagccggtggtggagaagatgcgtcgggaccgcatcaacagcagcattgagcagctgaaa
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaaactggagaaggccgac
atcctggagatggccgtcagctacctgaagcacagcaaagccttcgccgcggccgccggc
cccaagagcctgcaccaggactacagcgagggttactcgtggtgcctgcaggaggcggtg
cagttcctgaccctgcatgcagccagcgacacgcagatgaagctgctttaccacttccag
cggcccccagctcccgccgcgcctgtcaaggagaccccgacgcccggcgctgcgccccag
ccggcgcgctcctccactaaggccgccgcctccgtctccacctcgcgccaatctgcctgc
ggcctctggcggccctggtga

DBGET integrated database retrieval system