KEGG   Rattus norvegicus (rat): 79237
Entry
79237             CDS       T01003                                 

Gene name
Hhex, Hex
Definition
(RefSeq) hematopoietically expressed homeobox
  KO
K08024  homeobox protein HEX
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    79237 (Hhex)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    79237 (Hhex)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79237 (Hhex)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    79237 (Hhex)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 79237
NCBI-ProteinID: NP_077361
RGD: 619932
Ensembl: ENSRNOG00000016595
UniProt: Q9WV22
Position
1q53
AA seq 271 aa
MQFPHPGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPAAPTPTPTLPSPNSSFT
SLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDP
LGKPLLWNPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSER
QVKTWFQNRRAKWRRLKQENPQSNKKDELDSLDTSCDQGQDLPSEQNKGASLDSSQCSPS
PASPEDPESEISEDSDQEVDIEGDKGYFNAG
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcagttcccgcacccggggcccgcggctgcgcccgccgtcggagtcccgctgtacgcg
cccacgccgctgctgcagcccgctcacccgacgcctttctacatcgacgacatcctgggt
cgcgggcccgccgctcccacgcccactcccacgctgccgtcccccaactcctccttcacc
agcctcgtgtcctcctaccggaccccggtgtacgagcccacgccggtccaccccgccttc
tcgcatcaccccgccgccgcgctggccgctgcctatggccccggtggcttcggaggccct
ctgtacccgttcccgcggacggtgaacgactacacgcacgccctactccgccacgacccc
ctgggcaagcccttgctctggaaccccttcctacagcgacctctgcacaaaaggaaaggc
ggtcaagtgaggttttccaacgaccagaccatcgagctggagaagaagttcgagactcag
aaatacctctccccacctgagagaaagcgtctggccaagatgttgcagctcagcgagaga
caggtcaaaacctggtttcagaatcgcagagctaaatggagacgactgaagcaggagaat
cctcaaagcaataaaaaggatgagttggacagtttggacacttcctgtgaccagggccaa
gacttgcccagtgaacagaataaaggtgcctctttggacagttctcagtgttcaccctcc
ccagcctctccggaagaccctgaatcagagatctcagaggattccgaccaggaagtggac
atcgagggtgataaaggctattttaatgctggatga

DBGET integrated database retrieval system