KEGG   Rattus norvegicus (rat): 79239Help
Entry
79239             CDS       T01003                                 

Gene name
Hmox2, Ho-2
Definition
(RefSeq) heme oxygenase 2
  KO
K21418  heme oxygenase 2 [EC:1.14.14.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00860  Porphyrin and chlorophyll metabolism
rno01100  Metabolic pathways
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    79239 (Hmox2)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    79239 (Hmox2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     79239 (Hmox2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Heme_oxygenase DUF1299
Motif
Other DBs
NCBI-GeneID: 79239
NCBI-ProteinID: NP_001264002
RGD: 67402
Ensembl: ENSRNOG00000003773
UniProt: P23711
Position
10q12
AA seq 315 aa AA seqDB search
MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENW
EEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTG
EGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAG
SMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILA
ASVALVAGLLAWYYM
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaggtggagacctcggagggcgtcgatgagtcagagaacaactctacggca
ccagaaaaggaaaaccataccaaaatggcagacctttctgagctcctgaaggaagggacc
aaggaagcacatgaccgggcagaaaatacccagtttgtcaaagacttcttgaaaggaaac
attaagaaggagctatttaagctggccaccactgcactttacttcacatactcagccctt
gaggaggaaatggatcgcaacaaggaccacccagccttcgcccccttatatttccccacg
gaactacaccggaaggaagcactgatcaaggacatggagtatttctttggtgaaaactgg
gaggagcaggtgaagtgctccgaggctgcccagaagtatgtggatcggattcactacgta
ggacagaatgagccagagctgctggtggcccatgcttacactcgttacatgggggacctt
tcgggaggccaggtgctgaagaaggtggctcagcgggcactaaaactccccagcactggg
gaagggacccagttctacctgttcgagcatgtggacaatgcccagcaattcaagcagttc
taccgtgccaggatgaatgccttggacctgagtatgaagaccaaagagaggattgtggag
gaggccaacaaagcctttgaatataatatgcagatattcagtgaactggaccaggctggc
tccatgctaacaaaagaaaccctggaggatgggctcccagtacatgatgggaaaggagat
gtacgtaaatgccccttttatgctgctcagccagacaaaggtaccctgggaggcagcaac
tgccccttccggacagccatggctgtgctgaggaagcctagcctgcagctcattctggct
gccagtgtggccttggtagctggactcttggcctggtactacatgtga

DBGET integrated database retrieval system