KEGG   Rattus norvegicus (rat): 79240Help
Entry
79240             CDS       T01003                                 

Gene name
Nr4a1, HMR, Ngfi-b, Nur77
Definition
(RefSeq) nuclear receptor subfamily 4, group A, member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    79240 (Nr4a1)
   04151 PI3K-Akt signaling pathway
    79240 (Nr4a1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    79240 (Nr4a1)
   04927 Cortisol synthesis and secretion
    79240 (Nr4a1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    79240 (Nr4a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79240 (Nr4a1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    79240 (Nr4a1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    79240 (Nr4a1)
Nuclear receptors [BR:rno03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   79240 (Nr4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 79240
NCBI-ProteinID: NP_077364
RGD: 620029
Ensembl: ENSRNOG00000007607
Vega: OTTRNOG00000001632
UniProt: P22829
Structure
PDB: 

Position
7q36
AA seq 597 aa AA seqDB search
MPCIQAQYGTPATSPGPRDHLTGDPLALEFSKPTMDLASPETAPTAPATLPSFSTFMDGG
YTGEFDTFLYQLPGTAQPCSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLD
ETLSSSGSDYYGSPCSAPSPPTPNFQPSQLSPWDGSFGHFSPSQTYEGLRVWTEQLPKAS
GPPPPPTFFSFSPPTGPSPSLAQSSLKLFPAPATHQLGEGESYSVPAAFPGLAPTSPNCD
TSGILDAPVTSTKARSGSSGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKY
ICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASP
TNLLTSLIRAHLDSGPNTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWA
EKIPGFIELSPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGD
WIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMAA
VAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtatccaagctcaatatggaacaccagcaaccagcccaggaccgcgtgaccac
ctgacaggtgaccccctggcccttgagttcagcaagcccaccatggacctggccagcccc
gagacggcgcccaccgcacctgccaccctgcccagtttcagcaccttcatggacggcgga
tacaccggagagtttgacaccttcctataccagctgccggggacagcccagccgtgctcc
tcggcctcctccacatcttcttcctcgtcctcggccacctctcccgcgtcggcttccttt
aagtttgaggactttcaggtgtatggctgctaccctggcaccctgagcggcccattagac
gagaccctgtcctccagtggctctgattactatggaagcccctgctcagccccgtcacca
cctacacccaacttccagccatcccagctctccccttgggatggttcatttggccacttc
tcccccagccagacttatgaaggccttcgggtatggactgagcagttgcccaaggcttcc
gggcctccgccacctccaaccttcttctccttcagtcctcccaccggtcccagccccagc
ctggcccagagttccctgaagttgttcccagcaccagccacccaccagctaggggagggg
gagagctattccgtgccagccgctttcccgggcttggcacccacctctccgaactgtgac
acttccggcattctggacgcacccgtaacctccaccaaggcccgcagtgggtcttcaggg
ggcagtgagggccgctgtgctgtctgtggagacaacgcttcgtgccagcattatggggtc
cgcacctgtgagggctgcaaaggcttcttcaagcgcacagtacagaaaagtgccaagtac
atctgcctggcaaacaaggactgccctgtggacaagaggcggcggaaccgctgccagttc
tgtcgcttccagaagtgcctggctgtgggcatggtgaaggaagttgtccggacagacagc
ctaaaggggcggcggggccggctaccttcaaaacccaagcagcccccagatgcctcccct
accaatctcctcacgtccctcattcgagcacatttggactccgggcctaacactgccaag
ttggactattccaagttccaggaactggtgctgccccgctttggaaaggaagatgccggt
gacgtgcagcaattttatgacttgctctctggctccctggacgtcatccggaagtgggcg
gaaaagatcccgggcttcattgagctttccccaggagaccaagacctgttgctagagtcc
gcctttctggagctctttatcctccgcctggcctaccgatctaagcccggtgaggggaag
ctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgcggctttggtgac
tggatagacaacattctagccttctcacggtccctgcacagcttgggtgttgatgttcct
gcctttgcctgcctgtctgctctggtcctcatcactgatcgacatggcctccaggaccct
cggcgggtggaggagctgcagaaccgcattgctagctgtctgaaggaacacatggccgcc
gtggcaggagacccacagccggccagctgcctgtcacgtctgctgggcaaactgcctgag
ctccggactctgtgcacccaaggcctacagcgcatcttttgcctcaagctggaggacttg
gtgccccctccacctatcgtggacaagatctttatggacaccttgtctttctga

DBGET integrated database retrieval system