KEGG   Rattus norvegicus (rat): 79243
Entry
79243             CDS       T01003                                 

Symbol
Hsd17b2
Name
(RefSeq) estradiol 17-beta-dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    79243 (Hsd17b2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    79243 (Hsd17b2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     79243 (Hsd17b2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     79243 (Hsd17b2)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Polysacc_synt_2 Epimerase
Other DBs
NCBI-GeneID: 79243
NCBI-ProteinID: NP_077367
RGD: 621803
Ensembl: ENSRNOG00000013982
UniProt: Q62730 Q5I0N4
Position
19:45753576..45825203
AA seq 381 aa
MNPFSSESAWLCLTATAVLGGMLLCKAWSSGQLRSQVVCLAGLWGGACLLSLSLLCSLFL
LSVSCFFLLYVSSSDQDLLPVDQKAVLVTGADSGFGHALAKHLDKLGFTVFAGVLDKEGP
GAEELRKNCSERLSVLQMDVTKPEQIKDVHSEVAEKIQDKGLWAVVNNAGVLHFPIDGEL
IPMTVYRKCMAVNFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAMIPFQMMAAYASTKAAI
SMFSAVIRQELAKWGVKVVTIHPGGFQTNIVGSQDSWDKMEKEILDHFSKEIQENYGQEY
VHTQKLALPVMREMSNPDITPVLRDIQHAICAKNHSSFYCSGRMTYLWICFAAYSPISLL
DYILKNYFTPKLMPRALRTAS
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaacccgttttcctctgagtcagcatggctctgcttgactgccactgcggtgctgggg
ggcatgcttctctgcaaagcctggagttcagggcagctaaggagccaggtggtgtgtctg
gctggcctctggggaggtgcctgcctgctcagcctgtccctcctctgcagcttgttcctc
ttatcggtgtcctgcttcttccttctgtatgtgagttcatctgaccaagacttgttacct
gtggatcaaaaggctgtgctggtgacaggtgccgattccggtttcggtcatgctttggcc
aagcacctggacaagctgggtttcacagtgtttgctggagtgctggataaagagggccca
ggagcggaggaattgaggaaaaactgctctgagcgcctttcggtgctccagatggatgtc
accaagccagagcagataaaagatgttcacagcgaagtcgcagagaagatacaagacaaa
ggactgtgggctgtggtcaacaatgctggggtcttgcactttccgatcgacggggaactc
attcccatgaccgtgtacagaaaatgcatggcagtgaacttcttcggagccgtcgaggtc
accaaggtgtttctgcctctacttagaaagtccaaggggaggctggttaacgtcagcagc
atgggagccatgattccatttcagatgatggccgcctacgcctccacgaaggcagctata
agcatgttctcagccgtcatcaggcaagagcttgccaaatggggagtcaaagtcgtgacc
atccatcctggaggcttccaaacaaacatcgtaggctcacaggacagttgggataaaatg
gagaaggagatcctggaccacttttccaaagagattcaggagaactatggacaggaatat
gtccatacgcagaagctcgccctcccggtcatgagagagatgtccaacccggatatcacc
cctgtgctgcgggacatccagcacgccatttgtgccaagaaccactcttccttttattgc
tcagggagaatgacttacctgtggatctgcttcgcggcctactccccgatcagcttattg
gactatattttgaaaaactattttactccaaaactcatgccaagagctttaaggacagca
agttag

DBGET integrated database retrieval system