KEGG   Rattus norvegicus (rat): 79243Help
Entry
79243             CDS       T01003                                 

Gene name
Hsd17b2
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    79243 (Hsd17b2)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    79243 (Hsd17b2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     79243 (Hsd17b2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     79243 (Hsd17b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Polysacc_synt_2 NmrA Epimerase
Motif
Other DBs
NCBI-GeneID: 79243
NCBI-ProteinID: NP_077367
RGD: 621803
Ensembl: ENSRNOG00000013982
UniProt: Q62730
Position
19q12
AA seq 381 aa AA seqDB search
MNPFSSESAWLCLTATAVLGGMLLCKAWSSGQLRSQVVCLAGLWGGACLLSLSLLCSLFL
LSVSCFFLLYVSSSDQDLLPVDQKAVLVTGADSGFGHALAKHLDKLGFTVFAGVLDKEGP
GAEELRKNCSERLSVLQMDVTKPEQIKDVHSEVAEKIQDKGLWAVVNNAGVLHFPIDGEL
IPMTVYRKCMAVNFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAMIPFQMVAAYASTKAAI
SMFSAVIRQELAKWGVKVVTIHPGGFQTNIVGSQDSWDKMEKEILDHFSKEIQENYGQEY
VHTQKLALPVMREMSNPDITPVLRDIQHAICAKNPSSFYCSGRMTYLWICFAAYSPISLL
DYILKNYFTPKLMPRALRTAS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgttttcctctgagtcagcatggctctgcttgactgccactgcggtgctgggg
ggcatgcttctctgcaaagcctggagttcagggcagctaaggagccaggtggtgtgtctg
gctggcctctggggaggtgcctgcctgctcagcctgtccctcctctgcagcttgttcctc
ttatcggtgtcctgcttcttccttctgtatgtgagttcatctgaccaagacttgttacct
gtggatcaaaaggctgtgctggtgacaggtgccgattccggtttcggtcatgctttggcc
aagcacctggacaagctgggtttcacagtgtttgctggagtgctggataaagagggccca
ggagcggaggaattgaggaaaaactgctctgagcgcctttcggtgctccagatggatgtc
accaagccagagcagataaaagatgttcacagcgaagtcgcagagaagatacaagacaaa
ggactgtgggctgtggtcaacaatgctggggtcttgcactttccgatcgacggggaactc
attcccatgaccgtgtacagaaaatgcatggcagtgaacttcttcggagccgtcgaggtc
accaaggtgtttctgcctctacttagaaagtccaaggggaggctggttaacgtcagcagc
atgggagccatgattccatttcagatggtggccgcctacgcctccacgaaggcagctata
agcatgttctcagccgtcatcaggcaagagcttgccaaatggggagtcaaagtcgtgacc
atccatcctggaggcttccaaacaaacatcgtaggctcacaggacagttgggataaaatg
gagaaggagatcctggaccacttttccaaagagattcaggagaactatggacaggaatat
gtccatacgcagaagctcgccctcccggtcatgagagagatgtccaacccggatatcacc
cctgtgctgcgggacatccagcacgccatttgtgccaagaacccctcttccttttattgc
tcagggagaatgacttacctgtggatctgcttcgcggcctactccccgatcagcttattg
gactatattttgaaaaactattttactccaaaactcatgccaagagctttaaggacagca
agttag

DBGET integrated database retrieval system