KEGG   Rattus norvegicus (rat): 79245
Entry
79245             CDS       T01003                                 

Gene name
Hsf1
Definition
(RefSeq) heat shock factor protein 1
  KO
K09414  heat shock transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    79245 (Hsf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79245 (Hsf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Heat shock factors
    79245 (Hsf1)
SSDB
Motif
Pfam: Vert_HS_TF HSF_DNA-bind ZapB
Other DBs
NCBI-GeneID: 79245
NCBI-ProteinID: NP_077369
RGD: 620913
Ensembl: ENSRNOG00000021732
UniProt: F1MAF1
Position
7
AA seq 525 aa
MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSSSAHSVPKYGRQYSLEHVHGPGPY
SAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKEE
PPSPPHSPRVLEASPGRPASMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPAP
PAPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDLFSPSVTM
PDMSLPDLDSSLASIQELLSPQEPPRPIEAENSNADSGKQLVHYTAQPLFLLDPDAVDTG
SSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggatctggctgtgggccccggtgcagcggggcccagcaacgtcccggccttcctaacc
aagctgtggaccctcgtgagcgacccggacacagacgcgctcatctgctggagcccgagt
gggaacagcttccacgtgtttgaccagggccagtttgccaaggaggtgctgcccaagtac
ttcaagcacaacaacatggccagctttgtgcggcagctcaacatgtatggcttccgaaaa
gtagtccacattgagcagggtggcctggtcaagcctgagagggatgacaccgagttccag
catccatgtttcctgcgtggccaggaacagctccttgagaatatcaagaggaaagtgacc
agcgtgtccaccctgaagagtgaggacataaaaatacgccaggacagtgtcaccaggctg
ttgacagatgtgcagctgatgaaggggaaacaggagtgtatggactccaagctcctggcc
atgaagcacgagaacgaggccctgtggcgggaggtggccagccttcggcagaagcatgcc
cagcagcaaaaagttgtcaacaagctcatccaattcctgatctcactggtgcagtcgaac
cggatcctgggggtgaagagaaagatccctctgatgttgagtgacagcagctcagcacac
tctgtgcccaagtatggtcgacagtactccctggagcatgtccatggtcccggcccatac
tcagctccatctccagcctacagcagctctagcctttactcctctgatgctgtcaccagc
tctgggcccataatctccgatatcactgagctggctcccaccagccctttggcctcccca
ggcaggagcatagatgagaggcctctgtccagcagcaccctggtccgtgtcaaggaagag
ccccccagcccacctcatagccctcgggtactggaggcaagccctgggcgcccagcctcc
atggatacccctttgtccccaactgccttcattgactccatccttcgagagagcgaacct
acccctgctgcctcaaacacagcccctatggacacaaccggagcccaagcccctgcaccc
ccagccccctccacccctgagaagtgcctcagcgtagcctgcctagacaagaacgagcta
agtgatcacctggatgccatggactccaacctggacaacctgcagaccatgctgacaagc
cacggcttcagtgtggacaccagtgccctgctggacctgttcagcccctcggtgaccatg
cccgacatgagcctgcctgacctggacagcagcctggccagcattcaggaacttctatct
ccccaagagcctcccaggcctattgaggcagagaatagtaacgccgactcaggaaagcag
ctggtgcactacacggctcagcctctgttcctgctggaccctgatgctgtggacacaggg
agcagtgaactgcctgtgctctttgagctgggggagagctcctacttctctgagggagat
gactacacggatgatcccaccatctctcttctgacgggcactgaaccccacaaagccaag
gaccccactgtctcctag

DBGET integrated database retrieval system