KEGG   Rattus norvegicus (rat): 79246Help
Entry
79246             CDS       T01003                                 

Gene name
Htr3a, 5-HT3, 5-HT3A, 5HT3, Htr3
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04726  Serotonergic synapse
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    79246 (Htr3a)
  09157 Sensory system
   04742 Taste transduction
    79246 (Htr3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    79246 (Htr3a)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   79246 (Htr3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 79246
NCBI-ProteinID: NP_077370
RGD: 61818
Ensembl: ENSRNOG00000006595
UniProt: P35563 Q62999
Position
8q23
AA seq 483 aa AA seqDB search
MPLCIPQVLLALFLSVLIAQGEGSRRRATQAHSTTQPALLRLSDHLLANYKKGVRPVRDW
RKPTLVSIDVIMYAILNVDEKNQVLTTYIWYRQFWTDEFLQWTPEDFDNVTKLSIPTDSI
WVPDILINEFVDVGKSPSIPYVYVHHQGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRTPEEVRSDKSIFINQGEWELLGVFTKFQEFSIETSNSYAEMKFY
VVIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTL
PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRHLVLDRIAWLL
CLGEQPMAHRPPATFQANKTDDCSAMGNHCSHVGSPQDLEKTSRSRDSPLPPPREASLAV
RGLLQELSSIRHSLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIW
HYS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctgcatcccgcaggtgctgttggccttgttcctttccgtgctgatagcccag
ggagaaggcagccggaggagggccacccaggcccacagcaccacccagcctgctctgctg
aggctgtcagatcacctcctggctaactacaagaagggagtgcggcctgtgcgggactgg
aggaagcccaccctggtctccattgatgtcatcatgtatgccatcctcaacgtggatgag
aagaaccaggttctgaccacctacatatggtaccggcagttctggaccgacgagtttcta
cagtggactcctgaggacttcgacaatgtcaccaaattgtccatccccaccgacagcatc
tgggtccctgacatcctcatcaatgagtttgtggacgtggggaagtctccaagcattcct
tatgtgtatgtgcaccatcaaggtgaagtccagaactacaagcccctacagctggtgacc
gcctgtagccttgacatctataacttcccgttcgatgtgcagaactgctctctgaccttc
accagctggctgcataccatccaggacatcaacatttccctgtggcgaacaccagaagaa
gtgaggtcggacaagagcatcttcataaatcagggcgagtgggagctgctgggggtgttc
accaaatttcaggagttcagtatagaaaccagtaacagctatgcggaaatgaagttctac
gtggtcatccgccggcggcctttattctacgcagtcagcctcttgctgcccagtatcttc
ctcatggtcgtggacattgtgggcttttgtctgcccccggacagtggtgagagagtgtct
ttcaagatcacgctccttctgggatactcagtctttctcatcatcgtgtcagacacactg
cctgcaacggccatcggcactcccctcattggtgtctactttgtagtgtgcatggctctg
ctggtgataagcctcgctgagaccatcttcattgtgcagctggtgcataagcaggattta
cagcgccctgtacctgactggctgaggcacctggtcctagacagaatagcctggctgctc
tgcctaggggagcagcccatggcccataggcccccagccaccttccaagccaacaagact
gatgactgctcagccatgggaaaccactgcagccatgtcggaagccctcaggacttggag
aagacctcgaggagcagagatagccctcttccaccaccaagggaggcctcgctggctgtg
cgtggcctcttgcaagagctgtcctccatccgccactccctggagaagcgggatgagatg
cgggaggtggcaagggactggttgcgggtgggatatgtgctggacaggctgctgtttcgc
atctacctgctggccgtgctggcttacagcatcaccctggtcacgctctggtccatttgg
cattattcctga

DBGET integrated database retrieval system