KEGG   Rattus norvegicus (rat): 79248
Entry
79248             CDS       T01003                                 

Gene name
Abca2
Definition
(RefSeq) ATP-binding cassette sub-family A member 2
  KO
K05642  ATP-binding cassette, subfamily A (ABC1), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    79248 (Abca2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    79248 (Abca2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    79248 (Abca2)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    79248 (Abca2)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC_tran AAA_21 AAA_23
Other DBs
NCBI-GeneID: 79248
NCBI-ProteinID: NP_077372
RGD: 620238
Ensembl: ENSRNOG00000014268
UniProt: Q9ESR9
Position
3
AA seq 2434 aa
MGFLHQLQLLLWKNVTLKRRSPWVLAFEIFIPLVLFFILLGLRQKKPTISVKEAFYTAAP
LTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLNRVVEESNLFDPERPSLGSEL
EALHQRLEALSSGPGTWESHSARPAVSSFSLDSVARDKRELWRFLMQNLSLPNSTAQALL
AARVDPSEVYRLLFGPLPDLDGKLGFLRKQEPWSHLGSNPLFQMEELLLAPALLEQLTCA
PGSGELGRILTMPEGHQVDLQGYRDAVCSGQATARAQHFSDLATELRNQLDIAKIAQQLG
FNVPNGSDPQPQAPSPQSLQALLGDLLDVQKVLQDVDVLSALALLLPQGACAGRAPAPQA
GSPSGPANSTGVGANTGPNTTVEEGTQSPVTPASPDTLQGQCSAFVQLWAGLQPILCGNN
RTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPKILYAPAGSEADHVILKANETFA
FVGNVTHYAQVWLNISAEIRSFLEQGRLQQHLHWLQQYVADLRLHPEAMNLSLDELPPAL
RLDYFSLPNGTALLQQLDTIDNAACGWIQFMSKVSVDIFKGFPDEESIVNYTLNQAYQDN
VTVFASVIFQTRKDGSLPPHVHYKIRQNSSFTEKTNEIRRAYWRPGPNTGGRFYFLYGFV
WIQDMIERAIINTFVGHDVVEPGNYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVA
MTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVLMHS
HVLIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGIIYFLSYVPYMYVAIREEVAHD
KITAFEKCIASLMSTTAFGLGSKYFALYEVAGVGIQWHTFSQSPVEGDDFNLLLAVTMLM
VDTVVYGVLTWYIEAVHPGMYGLPRPWYFPLQKSYWLGSGRTETWEWSWPWAHAPRLSVM
EEDQACAMESRHFEETRGMEEEPTHLPLVVCVDKLTKVYKNDKKLALNKLSLNLYENQVV
SFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDQLT
VEEHLWFYSRLKSMAQEEIRKEMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGG
SRAIILDEPTAGVDPYARRAIWDLILKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLK
CCGSPLFLKGAYGDGYRLTLVKRPAEPGTSQEPGMASSPSGRPQLSNCSEMQVSQFIRKH
VASSLLVSDTSTELSYILPSEAVKKGAFERLFQQLEHSLDALHLSSFGLMDTTLEEVFLK
VSEEDQSLENSEADVKESRKDALPGAEGLTAVESQAGNLARCSELAQSQASLQSASSVGS
ARGDEGAGYTDGYGDYRPLFDNLQDPDSVSLQEAEMEALARVGQGSRKLEGWWLKMRQFH
GLLVKRFHCARRNSKALCSQILLPAFFVCVAMTVALSVPEIGDLPPLVLSPSQYHNYTQP
RGNFIPYANEERREYRLRLSPDASPQQLVSTFRLPSGVGATCVLKSPANGSLGPMLNLSS
GESRLLAARFFDSMCLESFTQGLPLSNFVPPPPSPAPSDSPLSPDEDSLLAWNTSLPPTA
GPETWTWAPSLPRLVHEPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTGDILTDITGHNVS
EYLLFTSDRFRLHRYGAITFGNIQKSIPAPIGTRTPLMVRKIAVRRVAQVLYNNKGYHSM
PTYLNSLNNAILRANLPKSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFII
VAMSFVPASFVVFLVAEKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCIIILF
VFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITAT
VATFLLQLFEHDKDLKVVNSYLKSCFLIFPNYNLGHGLMEIAYNEYINEYYAKIGQFDKM
KSPFEWDIVTRGLVAMTVEGFVGFFLTIMCQYNFLRQPQRLPVSTKPVEDDVDVASERQR
VLRGDADNDMVKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKM
LTGDESTTGGEAFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPW
KDEAQVVRWALEKLELTKCADKPAGSYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPK
ARRFLWNLILDLIKTGRSVVLTSHSMEECEAVCTRLAIMVNGRLRCLGSIQHLKNRFGDG
YMITVRTKSSQNVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEHVVG
VLGIEDYSVSQTTLDNVFVNFAKKQSDNVEQQEAEPSTLPSPLGLLSLLRPRPAPTELRA
LVADEPEDLDTEDEGLISFEEERAQLSFNTDTLC
NT seq 7305 nt   +upstreamnt  +downstreamnt
atgggcttcctgcaccagctgcagctgctgctctggaagaacgtgacgctgaagcgccgg
agcccgtgggtcctggcgtttgagatcttcatcccccttgtcctcttcttcatcctgttg
ggactgcggcagaagaagcccaccatctctgtgaaggaagctttctacacggcagcaccg
ctgacatcggccggcatcctgcctgtcatgcagtcgctttgccctgatggccagcgtgat
gagtttggcttcctgcagtatgccaactccacggtcacccagcttctggaacgcctcaac
cgtgtagtggaagagagcaacttgtttgacccagagcgacctagcctgggctcagagctt
gaggcactgcaccaacgtctggaggccctcagctcgggccctggcacctgggagagccac
tcagctagacctgcagtttcatccttctctctggactcggtggccagggacaaaagagag
ctttggcgtttcctgatgcagaacctgtcactgcccaacagcacggcccaggccctcctg
gctgcccgtgtagacccttctgaggtctatcgcttgctttttggtcctttacctgacctg
gatggaaagttggggttcctcaggaagcaggagccctggagtcacctgggtagcaatcct
ctgttccaaatggaggagctgctgctggctcctgcccttttggagcaactcacatgtgct
ccaggctctggggagctgggccggattcttaccatgcctgagggtcatcaggtagacctt
cagggctaccgggatgctgtctgcagcgggcaggctacagctcgtgcccagcatttcagt
gatctagccactgagctccggaaccagctggacatagccaagattgcccagcagctgggc
ttcaatgtccccaacggctcagatccacagccgcaggcaccgtccccacagagtctgcag
gcactcttaggggacctgctggatgtccagaaggttctacaggatgtggatgtcctatca
gcccttgccctgctgctgcctcaaggtgcctgtgctggccgggcccccgcacctcaagct
ggcagcccgagtggcccggccaacagcaccggggtaggggcaaatacaggtcccaacacc
accgttgaggagggcacccagtcacctgtcaccccagcctctccggacactctgcaaggc
cagtgctcagcctttgtgcagctctgggctggcttgcagcccatcttgtgtggcaacaac
cgtaccattgagcctgaagcactccggaggggcaacatgagctcactgggctttacgagc
aaagaacaacggaacctgggccttcttgtgcacctcatgaccagcaaccccaaaatcctg
tatgcacccgcaggctctgaagctgaccatgttatcctcaaggcaaatgagacctttgcc
tttgtgggcaacgtgacgcactacgcccaggtctggctcaacatctccgcagagatccgg
agcttcctggagcagggcaggctgcagcagcatctgcactggctgcagcagtacgtggct
gacctccggctacaccctgaagcaatgaacctgtcactggacgagctgccccctgctctg
cgcctggactacttttctctgcccaatggcacagcccttctgcagcagctagacacaata
gacaatgcagcctgtggctggatccagttcatgtccaaggtgagtgtggacatcttcaag
gggtttcctgatgaggagagcatcgtgaactacactctcaatcaggcctaccaggacaat
gttacagtatttgccagcgtgattttccagacacggaaggatggttccctccccccacat
gtccattacaagattcgccagaactcaagcttcaccgagaaaaccaacgagatccgtcgt
gcttactggcgtccagggcccaacactggtggccgcttctacttcctctacggcttcgtc
tggatccaggacatgatagaacgtgccatcatcaacacgtttgtggggcacgacgtggtc
gaacccggcaactacgtgcagatgttcccgtacccctgctacacccgtgacgacttcctg
tttgtcattgagcacatgatgccactgtgcatggtgatctcctgggtttactctgtggcc
atgaccatacagcacatcgtggcggagaaagagcatcggctaaaggaggtgatgaagacg
atgggcctgaacaacgccgtgcactgggtggcctggttcatcacgggctttgtgcagctg
tccatctccgtgacagccctgaccgccatcctcaagtatggccaggtcctcatgcacagc
cacgtgctcatcatatggctcttccttgctgtctatgctgtggccactatcatgttctgc
ttcctggtgtctgtgctgtactctaaggccaagttggcctcggcctgcggcggcatcatc
tacttcctgagctacgttccctacatgtatgtagcaatccgtgaggaagtagcccacgat
aagatcactgccttcgagaagtgcattgcgtccctgatgtccacaacagccttcggcctg
ggttccaagtactttgctctgtatgaagtggcaggtgtgggcatccagtggcacacgttc
agccagtccccagtggaaggggatgacttcaacctgctccttgctgtcaccatgctgatg
gtggacacagtggtctatggcgtactcacttggtacattgaggctgtgcacccaggtatg
tatgggctgccccggccctggtacttcccactacagaagtcctattggctgggcagtggg
cggacagagacctgggagtggagctggccatgggcacacgcaccacgcctcagcgttatg
gaggaggaccaggcctgtgccatggagagccggcacttcgaggagactcgcggtatggag
gaggagcccacccacctgcctttggtcgtctgcgtggacaagctcaccaaggtctataaa
aatgacaagaagctggccttaaacaaactgagcctcaatctctacgagaaccaggtggtc
tctttcctaggccataacggggctggcaagaccactaccatgtctatcctgactggactg
ttcccacccacgtcgggctcagccactatctatggccacgacatccgcacagagatggat
gagatccgtaagaacctgggcatgtgcccacagcacaacgtgctctttgaccagctcact
gtggaggaacacctctggttctactcacgcctcaaaagcatggcacaagaggagatccgc
aaagagatggacaagatgatcgaggacctggagctctccaacaagcgccactcgctggta
cagacgctgtctggaggcatgaagcgcaagctttcagtagccattgccttcgtgggtggc
tctagagccattatcttagatgagcccacagctggcgtggacccctatgctcgacgtgcc
atctgggacctcattctgaagtacaagccgggtcgcactatcctcctgtccacccatcac
atggatgaggccgacctgctgggggaccgcattgccatcatctcccatgggaagctcaaa
tgctgcggctctcccctcttcctcaagggtgcctacggcgatggctaccgcctcacactg
gtcaagcggcctgcggagcctggcacctcccaagagccagggatggcttccagcccctca
ggtcgtcctcagctgagcaactgctcagagatgcaagtgtcccagttcatccgcaagcat
gtggcttcctccctgctggtgtcagacacgagcaccgagctctcctacatcctgcccagc
gaggctgtcaagaaaggggccttcgagcgcctctttcagcaattggagcacagcctggac
gcactgcatctgagcagttttgggctgatggacacaaccctggaggaggtgttcctcaag
gtgtctgaagaagaccagtcactggagaatagtgaggccgatgtgaaggagtcccggaag
gatgcactgcctggggcagagggcctgacggctgtggagagtcaagcaggcaacctggct
cggtgctcagagctggcacagtcccaggcttcactgcagtctgcatcttctgtgggctcc
gcccgtggggatgagggtgctggctacaccgacggctacggtgactaccgtcccctcttt
gacaacttgcaggacccagacagtgtcagcttacaagaggctgaaatggaggccctggct
cgggtaggccagggcagccgcaagctagagggctggtggctgaagatgcggcagttccat
gggctcctggtgaagcgcttccactgtgctcgccggaactccaaagcgctctgctcccag
attctgctgcctgccttcttcgtctgtgtggccatgactgtggcattgtctgtccctgag
atcggtgacctgcctccactggtcctgtcgccttctcagtaccacaactatacccagccc
cgtggcaactttatcccctatgccaatgaggaacgccgcgagtaccgattacggctgtca
cctgatgccagcccccagcagttggtgagcacattccggctgccctctggtgtgggtgcc
acttgtgtgctcaagtctccagccaacggctccctggggcccatgctgaacttgagcagt
ggagagtcccgcctgctggccgcacggttcttcgacagtatgtgcctggagtccttcaca
caggggctgccactgtccaacttcgtgccacccccaccctcgcccgccccttccgactca
cccctgtccccggatgaggattcactgctagcctggaatacgtccctgccccctactgct
ggaccagagacgtggacgtgggcgccttctctgccacgcctggttcacgagccggtccgc
tgtacctgctctgcacagggcacgggcttctcgtgccccagcagtgtgggtgggcaccca
ccccagatgagagtggtcacgggggacatcctgactgacatcaccggccacaatgtttcc
gagtacctgctcttcacctctgaccgtttccgactgcaccgctatggagccatcaccttt
ggtaatatccagaagtccatcccagcacccattggtacccggacccctctcatggtccgg
aagattgcagtgcggagggtggcccaggtgctctacaacaacaagggctaccacagcatg
cccacctacctcaacagcctcaacaatgccattctgcgtgcaaacctacccaaaagcaag
ggcaatccagcagcctacggtatcaccgtcaccaaccaccccatgaacaagaccagtgct
agcctctccctggattacctactgcagggcacagacgtggtcatcgccatcttcatcatt
gtggccatgtccttcgtgccggccagcttcgtggtcttccttgtggccgagaaatccacc
aaggccaaacacctgcagttcgtcagcgggtgcaaccctgtcatctactggctagccaac
tacgtgtgggacatgctcaattacctggtcccggccacctgctgcatcatcatcctcttc
gtgtttgacttgccggcctacacgtcacccaccaacttccccgcggtgctctccttgttc
ctgctctatggatggtccatcacacccatcatgtacccggcctccttctggtttgaggtc
cctagctcagcctacgtgttcctcatcgtcatcaacctcttcattggcatcacggccaca
gtggccaccttccttctgcagctctttgagcatgacaaggatctgaaggttgtcaacagt
tacctgaaaagctgcttcctcatcttccccaactacaacctgggccacggactcatggag
atagcctacaacgaatacatcaacgaatactatgccaagatcggccagtttgacaagatg
aagtccccgtttgagtgggacattgtcacacgtggactggtggccatgacagtcgagggc
ttcgtgggattctttctcaccatcatgtgtcaatataacttcctacggcagccacagcgt
ctgcctgtgtctactaaacctgtggaagacgatgtagacgtggccagtgagcggcaaaga
gtgctccgtggcgatgctgacaatgacatggtcaagatcgagaacctgactaaggtgtac
aagtctcggaagatcggccgcatcctggcagtggaccgcctttgcctgggtgtgcgcccc
ggagagtgctttgggctcctcggggtcaatggtgccgggaagaccagcaccttcaagatg
ttgactggagatgagagcacaacagggggcgaggcctttgtcaatggacacagtgtgctc
aaggacctgctccaggttcagcagagccttggctactgcccacagttcgacgccctgttc
gatgagctcacggctcgcgaacacctgcagctgtatactcggcttcgaggcatcccctgg
aaggatgaggcgcaggtggtgaggtgggccctggagaagctggagctgacgaagtgtgca
gacaagccagccggtagctacagtgggggcaacaaacggaaactttccacagccatcgct
ctcattgggtaccctgccttcatctttctagacgagcccaccactggcatggaccctaag
gcccggcgcttcctgtggaacctcattctggacctcatcaagacaggacgttcagtggtg
ctgacctcacacagcatggaggaatgcgaggctgtgtgcacacggctggccatcatggtg
aatggacggctgcgctgcctggggagtatccagcacctcaagaacaggtttggggacggc
tacatgatcactgtaaggaccaaaagcagccagaacgtgaaggatgtggtgcggttcttc
aaccggaacttcccagaggccatgctcaaggaacgccaccatacgaaggtgcagtatcag
ctcaagtcggagcacatctcgctggctcaggtgttcagcaagatggagcacgtggtcggt
gtactgggcatcgaggactactcagtcagccagaccactctggataacgtgtttgtgaac
ttcgccaagaagcaaagtgacaatgtggagcagcaagaggctgagccatccaccttgccg
tccccccttggactacttagcctgctgcggccccgccctgcacccacagagctccgggca
ctggtggccgatgagcctgaggacctggacacggaggacgagggcctcatcagcttcgag
gaagagcgggcccagctctccttcaacaccgatacgctctgctga

DBGET integrated database retrieval system