KEGG   Rattus norvegicus (rat): 79256Help
Entry
79256             CDS       T01003                                 

Gene name
Hnrnpd, Auf1, Hnrpd
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein D
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    79256 (Hnrnpd)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    79256 (Hnrnpd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 CBFNT RRM_3 NID Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 79256
NCBI-ProteinID: NP_077380
RGD: 620365
Ensembl: ENSRNOG00000002292
UniProt: Q9JJ54
Position
14p22
AA seq 353 aa AA seqDB search
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQGAAAAAGSGSGGGSAPGGTEGGSTE
AEGAKIDASKNEEDEGHSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGD
VVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVK
KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK
KYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGY
GSYGYNSQGYGGYGGYDYTGYNSYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagcagttcggaggggacggggcggcggcggcggcaacggcggcggtaggc
ggctcggcgggcgagcaggagggagccatggtggcggcggcgcagggggcagcggcggcg
gcgggaagcgggagcggcggcggctctgcgcccggaggcaccgaaggaggcagcaccgag
gcagagggagcgaagatcgacgccagtaagaatgaggaggatgaaggccattcaaactcc
tccccacgacacactgaagcagcgacggcacagcgggaagaatggaaaatgtttatagga
ggccttagctgggacaccacaaagaaagacctgaaggactacttttccaaatttggggac
gttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggttttggcttt
gtgctatttaaagagtcggagagtgtagataaggtcatggatcagaaagaacataaattg
aatgggaaagtcattgatcctaaaagggccaaagccatgaaaacaaaagagcccgtcaaa
aaaatttttgttggtggcctttctccagacacacctgaagaaaaaataagagagtacttt
ggtggttttggtgaggttgaatccatagagctgcctatggacaacaagaccaataagagg
cgtgggttctgtttcattacctttaaggaagaggaaccagtgaagaagataatggagaag
aaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcgaaggagcag
tatcagcagcagcagcagtggggatctagaggagggtttgcaggaagagctcgcggaaga
ggcggtggccccagtcaaaactggaaccagggatatagtaactattggaaccaaggctat
ggcagctatggatataacagccaagggtacggtggttatggaggatatgactacactggt
tacaacagctactatggatatggtgactatagcaatcagcagagtggttatgggaaagta
tccagacgaggtggtcatcaaaatagctacaaaccatactaa

DBGET integrated database retrieval system