KEGG   Rattus norvegicus (rat): 79423
Entry
79423             CDS       T01003                                 

Gene name
Stmn4
Definition
(RefSeq) stathmin-4 isoform c
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Stathmin Pex19
Other DBs
NCBI-GeneID: 79423
NCBI-ProteinID: NP_001257785
RGD: 69349
Ensembl: ENSRNOG00000053334
UniProt: P63043 Q568Y8
Structure
PDB: 

Position
15
AA seq 189 aa
MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS
GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKN
KELKEEASR
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccctcgcagcctataaggagaagatgaaggaactcccactagtgtctctgttctgc
tcctgttttctgtctgatcccctgaataaatcatcctacaaatatgaagcagatacggta
gacctgaactggtgtgtcatctctgatatggaagtcatcgagctgaataagtgtacctcg
ggccagtcctttgaagtcatcctgaagccaccttcctttgacggggtgcctgagtttaat
gcctccctcccaagacgtcgagacccatcgctagaagagatacagaagaagctagaagca
gcagaggagcgaaggaagtaccaggaagctgagctcctaaaacaccttgcagagaaacga
gagcatgagcgtgaggtaatccagaaagctatcgaggaaaacaacaacttcatcaagatg
gcgaaagagaagctggcccagaagatggagtccaataaggaaaaccgggaggcccatctg
gctgccatgttggagcggctgcaagagaaggacaagcacgcagaggaggtgcggaaaaac
aaggagctgaaggaagaggcctccaggtaa

DBGET integrated database retrieval system