KEGG   Rattus norvegicus (rat): 79425
Entry
79425             CDS       T01003                                 

Gene name
Clcnka, Clcnk1
Definition
(RefSeq) chloride voltage-gated channel Ka
  KO
K05017  chloride channel Ka
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    79425 (Clcnka)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel (CLC)
   79425 (Clcnka)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 79425
NCBI-ProteinID: NP_445779
RGD: 68435
Ensembl: ENSRNOG00000052368
UniProt: Q06393
Position
5q36
AA seq 687 aa
MEELVGLREGSSGKPVTLQELWGPCPRIRRGVRRGLEWLKERLFRVGEDWHFLVALGVLM
ALISYAMNFAIGRVVRAHKWLYREVGDGHLLRYLSWTVYPVALLSFSSGFSQSISPFSGG
SGLPELKTMLSGVVLEDYLDIKNFGAKVVGLSCTLATGSTIFLGKVGPFVHLSVMISAYL
GRVRAKTIGETENKAKEIEMLSAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVWNYWRGF
FAATCGAFMFRLLGVFNSEQETITSIYKTRFRVDVPFDLPEIFFFVALGFICGVLSCAYL
FCQRTFLRFIKTNRYTSRLLATSKPSYAALVALVLASITYPPGVGRFMASRLSMAEHLHS
LFDNNSWALMTRNSSPPWPAEPDPQNLWLEWCHPRFTIFGTLAFFLVMKFWMLILATTIP
MPAGYFMPIFIIGAAIGRLLGEALSVAFPEGIVAGREVNPIMPGGYALAGAAAFSGAVTH
TISTALLAFELTGQIVHALPVLMAVLAANAISQNCQPSFYDGTIMAKKLPYLPWIRGRQI
GSYPVTVEHFMNCNLTTLAKDTPLEEVVKVVTSTEVSQYPLVETRESQTLVGIVERTHLV
QALQTQPASWAPGQERFLQDILAGGCPTQPVTLQLSPETSLYQAHSLFERLTLQSLFVTS
RGKAVGSVSWAELKKAISTLINPPAPK
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggaagaactcgtgggactgcgtgagggctcctctgggaagccagtaactctgcaagag
ctatgggggccgtgtccacgcatccgccgaggtgtcagaaggggcctagagtggctgaaa
gagcggttgttccgtgtgggtgaggactggcacttcctggtggctctcggggtgctcatg
gctctgatcagctatgccatgaactttgccattggacgtgtggtcagagcacacaaatgg
ctataccgggaggttggggacggccacctgctccggtacctctcctggaccgtctaccct
gtggctcttctgtccttctcctccggcttctcgcagagcatctcacccttctctggaggg
tctggactcccagagctgaagaccatgctgtccggtgtggtcctggaggactacctagac
atcaagaacttcggggccaaggtggtgggcctctcctgcaccctggcaacaggcagtacc
atcttcctaggcaaagtgggccccttcgtgcacctgagcgtgatgatttctgcttatctg
ggccgagtgcgcgccaagaccattggggaaactgagaacaaggccaaggaaattgaaatg
ctctcggcggcagcggcagtgggcgtggccacagttttcgcagcccccttcagcggtgtc
ctgttcagcatcgaggtcatgtcctctcacttctccgtctggaattactggaggggcttc
tttgccgccacatgcggggccttcatgttccgtctcctaggggtcttcaacagtgaacag
gagaccatcacctccatctacaagaccagattccgagtggatgtgccctttgacctgcct
gaaatcttcttctttgtggctctggggttcatctgcggggtcctgagctgcgcgtacctg
ttctgtcagagaacttttctccgctttatcaagaccaatcggtacacctccagactgttg
gctacaagcaagccgtcctacgcagctctggttgccctggtcctggcctccatcacctat
ccacctggtgtgggtcgcttcatggcctcccggctgtccatggcagagcatttgcactct
ctgtttgacaacaactcttgggcactgatgacccgaaattcatccccaccctggcctgcg
gagccggacccccagaacctgtggttggaatggtgtcacccacggttcaccatctttggg
actctggccttcttcctggtcatgaagttctggatgctgattctggctaccacgatcccc
atgcctgctgggtatttcatgcccatattcatcattggagctgccattgggcgcctcttg
ggagaggccctgtctgtcgccttcccagagggcattgtggctggcagagaggtcaacccc
atcatgcctgggggctatgctctggcaggtgctgctgccttctcgggggcggtgacccac
accatctccacagcactgctggcctttgagctgaccggccagatcgttcatgcactgcct
gtgctgatggccgtgctggcggccaatgccatctctcaaaactgtcagccgtctttctac
gatggcaccatcatggccaagaaactgccgtacctgccgtggatccgtggccgacagatt
ggctcctaccctgtgactgtggaacacttcatgaactgtaacctcaccacgctggccaag
gacacgcccctggaggaggtggtcaaagttgtgacctctacagaagtgtctcaatatccc
ttggtggagaccagagagtctcagaccctggtgggcattgtggaacggacccacttggtg
caagccctccagacccagccagcttcctgggctccaggccaagagcgctttctccaggac
atcttggcaggtggctgccccacacagccagtgaccctgcagctgtccccagagacctcc
ctgtatcaggcacacagcctctttgagcggctgacccttcagtcgctgttcgtgacgtca
cggggcaaagctgtgggctctgtgtcctgggcggagctgaagaaagccatttccaccttg
atcaacccaccagcccccaagtga

DBGET integrated database retrieval system