KEGG   Rattus norvegicus (rat): 79429
Entry
79429             CDS       T01003                                 

Gene name
Pdgfc, SCDGF
Definition
(RefSeq) platelet derived growth factor C
  KO
K05450  platelet derived growth factor C/D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04810  Regulation of actin cytoskeleton
rno05215  Prostate cancer
rno05218  Melanoma
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    79429 (Pdgfc)
   04015 Rap1 signaling pathway
    79429 (Pdgfc)
   04010 MAPK signaling pathway
    79429 (Pdgfc)
   04020 Calcium signaling pathway
    79429 (Pdgfc)
   04072 Phospholipase D signaling pathway
    79429 (Pdgfc)
   04151 PI3K-Akt signaling pathway
    79429 (Pdgfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    79429 (Pdgfc)
   04540 Gap junction
    79429 (Pdgfc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79429 (Pdgfc)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    79429 (Pdgfc)
  09162 Cancer: specific types
   05218 Melanoma
    79429 (Pdgfc)
   05215 Prostate cancer
    79429 (Pdgfc)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    79429 (Pdgfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    79429 (Pdgfc)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   79429 (Pdgfc)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 79429
NCBI-ProteinID: NP_112607
RGD: 68410
Ensembl: ENSRNOG00000010695
UniProt: Q9EQX6
Position
2q33-q34
AA seq 345 aa
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNTVLVWRLVAVDENVRIQLTFDERFGLEDPEDDLCKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSA
LSLDLLNNAVTAFSTVEELIRFLEPDRWQIDLDSLYKPTWPLLGKAFLYGKKSKAVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKIGVKGLHKSLTDVALEHHEECDCVCRGNTEG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcctcggcctcctcctgctgacatctgccctggccggccagagaaccgggact
cgggctgagtccaacctgagcagcaagttgcagctctccagcgacaaggagcagaacgga
gtgcaagatccccggcatgagagagttgtcactatatctggtaatgggagcatccacagc
ccgaagtttcctcatacctacccaagaaatacggtgctggtctggagattagtggcagta
gatgaaaatgtgcggatccagctgacatttgatgagagatttgggctggaagacccagag
gacgatctatgcaagtatgattttgtagaagttgaggagcccagtgatggaagtgtatta
ggacgctggtgtggttctgggactgtgccaggaaagcagacttctaaaggaaatcatatc
aggataagatttgtatctgatgagtatttcccatctgaacccggattctgcatccactac
agtattatcatgccacaagtcacagaaactacgagtccttcagtgttgcccccttcagct
ttgtcattggacctgctcaataatgctgtgactgccttcagtactgtggaagagctgatt
cggttcctagagccagatcgatggcagatagacttggacagcctctacaagccaacatgg
ccgcttttgggcaaagctttcctgtatgggaaaaaaagcaaagcggtgaatctgaacctt
ctcaaagaagaggtaaaactttacagctgcacaccccggaacttctctgtgtccatacgg
gaagagctaaagaggacagacaccatattctggccaggttgtctcctggtcaagcgctgt
ggaggaaattgtgcctgttgcctccataattgcaatgaatgtcagtgtgtcccacgtaaa
gttacaaaaaagtaccatgaggtccttcagttgagaccaaaaattggagtcaagggattg
cataagtcgctcaccgatgtggccctggaacaccatgaggaatgtgactgtgtgtgtaga
ggaaacacagaagggtaa

DBGET integrated database retrieval system