KEGG   Rattus norvegicus (rat): 79433Help
Entry
79433             CDS       T01003                                 

Gene name
Myh10, MCH-B, NMMHC-B, SMemb
Definition
(RefSeq) myosin heavy chain 10
  KO
K10352  myosin heavy chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    79433 (Myh10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79433 (Myh10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     79433 (Myh10)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   79433 (Myh10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ AAA_22
Motif
Other DBs
NCBI-GeneID: 79433
NCBI-ProteinID: NP_113708
RGD: 71000
Ensembl: ENSRNOG00000002886
UniProt: Q9JLT0
Position
10q24
AA seq 1976 aa AA seqDB search
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEKPPHIYAISESAYRCMLQDRKDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGTSFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRNVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEGEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDE
LKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGMKFAKDAAGLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIEGLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQR
QIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHIEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 5931 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagaactggactggaggatcccgagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgactggacagctaaaaagctggtgtggattccatct
gaacgccatggttttgaggcagctagtattaaagaagaacggggcgatgaggttatggtg
gagctggcagagaacgggaagaaagcgatggtcaacaaagatgacattcagaagatgaac
ccgccgaagttctccaaggtggaggacatggcagagctcacgtgcttgaacgaagcctct
gttttacacaatctgaaggatcgctactattcaggactcatctatacttactcgggactc
ttctgtgtggtgataaatccctacaagaaccttccgatttactctgagaatattattgag
atgtacagagggaagaagcgccatgagaagccgccacacatctacgccatatcagagtct
gcctacagatgcatgcttcaagatcgtaaggaccagtcgattctttgcacgggtgaatca
ggtgccgggaagacagaaaatacaaagaaagtcattcagtaccttgcccacgttgcttct
tcacacaaaggaagaaaggaccacaatattcctggggaacttgaacggcagcttttacaa
gcaaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgctttggcaagtttatccggatcaactttgatgtaaccggctatattgttggggccaac
attgaaacataccttctggaaaagtcccgtgctgttcgtcaagctaaagatgaacgcacg
tttcatatcttttatcagttgctctctggagcaggggaacacctgaagtccgacttactc
ctggaaggctttaataactacagattcctctccaacggctacatccctattcctggacag
caagacaaggataactttcaggagaccatggaagccatgcacataatgggcttctctcac
gaagagatcctctcaatgcttaaagtcgtgtcttcagtgctgcagtttggaaacatctct
ttcaaaaaggagaggaacactgaccaagcttccatgcccgagaacacagttgcacagaaa
ctctgccacctgcttgggatgaatgtgatggagttcactcgggctatcctcacgcccagg
atcaaagttggccgagattatgtacagaaagcccagaccaaagagcaggcagattttgca
gtggaagcattggcaaaggctacctatgagcggttgtttcgctggctcgttcaccgcatc
aataaggcgctggataggaccaaacgccagggaacgtctttcattgggatcctggatatt
gctggttttgaaatttttgagctgaactcctttgaacaactatgcatcaactacaccaat
gagaagctgcagcagctgttcaaccacaccatgttcatcctggagcaggaggagtaccag
cgagagggcatcgagtggaacttcatcgactttggtctcgacttgcagccctgcatcgac
ctgatagagagacctgccaatccccctggtgtgctggccctcctggatgaagaatgctgg
ttccccaaagccacagacaaaacgtttgttgagaagctggttcaggagcaaggttcccac
tccaagtttcagaaaccacggcaactgaaagacaaagccgacttctgcatcatccactat
gcagggaaggtggactataaggcggatgagtggctgatgaagaacatggaccccctgaat
gacaacgtggccaccctcctgcaccagtcatcagacagatttgtcgccgagctttggaag
gatgtggaccgaattgtaggtctggatcaagtcactggcatgactgagacagcttttggc
tctgcatataaaaccaagaagggcatgttccgcaacgtcgggcagctctacaaagagtct
ctcaccaagctcatggcaaccctccgaaacaccaaccccaacttcgtacgctgcatcatt
ccaaatcacgagaagcgggctggaaaactggatccacatcttgtgctggatcagctccgc
tgtaacggtgtcctggaaggaatcaggatctgtcgccagggattccccaaccggatagtt
ttccaggagttcagacagagatatgagatcctaactcccaacgctattcccaaaggcttc
atggatggcaaacaggcctgtgagcgaatgatccgagctttagaactggacccaaacctg
tatagaattggacagagcaagatatttttccgagctggagttctggcgcacttagaggaa
gaaagagatttaaaaatcactgatataatcatctttttccaagctgtatgcagaggctac
ctagccagaaaggcctttgccaagaaacagcagcagctaagtgccttaaaggtcttgcag
cggaactgtgcggcgtacctgaagctgcgacactggcagtggtggcgcgtcttcacaaag
gtgaagcctctcctccaagtgacccgccaggaggaggagctccaggctaaagatgaggag
ctgctgaaggtgaaagagaagcagacaaaagtggaaggggaacttgaggagatggaacgg
aagcaccagcagctgctggaagagaagaatatcctggcagaacagctgcaggccgagact
gagctctttgctgaagcagaggagatgagagcaagactcgctgccaagaagcaggaactg
gaggagatcctccatgacctggagtccagggtggagggagaggaagagcgaaaccagatc
ctgcagaacgagaagaagaagatgcaagcgcacattcaggatctagaagagcaactggat
gaggaggagggggcgcggcaaaagctgcagctggagaaggtgaccgcggaggctaaaatc
aagaagatggaagaggaggttctgcttctcgaggaccagaattccaaatttatcaaagaa
aagaaactcatggaagatcgaattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcaaaaaacttagccaaaatcaggaataagcaagaagtgatgatctcggatttagaa
gaacgcttgaagaaggaggagaaaacacggcaggaactggaaaaggccaaacggaaactg
gacggtgaaacaactgatctgcaggaccagatcgccgagttgcaagcacaggtcgatgag
ctcaaagtccagttgaccaagaaggaggaggagcttcagggggcgctggccagaggagat
gatgagacgctgcacaagaataatgcgcttaaagttgcgcgggagctgcaggcccaaatc
gccgagctccaggaagactttgagtctgaaaaggcttcaaggaacaaggctgagaaacaa
aaacgggacctgagtgaggagctggaagctctaaagacagaactggaggacaccctagac
accacagcagctcagcaggaactccgcacaaagcgggagcaggaagtagctgagctgaag
aaggctcttgaggatgaaactaagaaccacgaagctcagatccaggacatgagacagagg
cacgccacggcactggaggaactctctgagcaactggaacaggctaagaggttcaaagcc
aatctggagaagaacaaacagggcctggagacggacaacaaggagctggcgtgtgaggtg
aaggtgctgcagcaagtcaaggctgagtcagagcacaagaggaagaagctcgatgcccag
gtccaggagctccacgccaaggtgtcagaaggtgacaggctcagggtagaactggccgag
aaagcaaacaagctacagaatgagctggataatgtctcaaccctgctggaagaagccgag
aagaaaggaatgaagttcgctaaggacgccgcaggtctcgagtctcagctacaggacaca
caggagctccttcaggaggagacgcggcagaaactgaacctgagcagtcggatccggcag
ctggaggaggagaagaacagccttcaggagcagcaggaggaggaagaggaggccaggaag
aacttggaaaagcaggtgttggccctgcagtcccagctggctgacaccaagaagaaagtg
gacgatgacctggggacaattgagggtttggaagaagccaagaagaaactgcttaaggac
gtggaggcactgagtcagcgactggaggaaaaggtcctagcatatgacaagctggagaag
accaagaaccggctgcaacaggagctggatgacctgacggtggacctggaccaccagcgc
cagatcgtctccaacttggagaagaaacagaagaagtttgaccagctgttggcagaagag
aagggcatctctgctcgctatgcagaagaacgggaccgggctgaagctgaggccagagag
aaagaaaccaaggcgctctccctggcgcgggccctggaggaggccttggaggccaaggag
gaattcgagaggcagaataagcagcttcgggcagacatggaagacctcatgagctcgaaa
gatgatgtggggaagaacgtccacgagctggagaagtccaagcgggccctggagcagcag
gtggaggagatgaggacccagctggaggagctggaggacgagttgcaggccactgaggac
gccaaactccgcctggaagtcaacatgcaggccatgaaggcccagtttgagagggacctg
caaaccagagatgagcagaatgaagagaagaagcggctgctgctcaagcaggtacgggag
ctcgaggcagagctggaggatgagcggaagcagcgggcacttgctgtggcttcaaagaag
aagatggagatagacctgaaggacctggaggctcagatcgaggccgccaacaaggcccgg
gatgaagtgatcaagcagcttcgcaagcttcaggcacagatgaaggattaccagcgtgaa
ctagaagaagctcgagcatctagagatgagatttttgctcaatccaaagaaagtgaaaag
aaactgaagagtctagaagcagaaatcctccagttgcaagaggagctggcctcatctgag
cgagcccgcagacacgcagagcaggagcgagatgagctggctgacgagattgccaacagc
gcctctgggaagtccgctctgctggatgagaagcggcgcctggaagcccggatcgcgcag
ctggaggaggagctagaagaggagcagagtaacatggagctgctcaatgaccgcttccgc
aagaccacgctccaggtggacaccctgaacacagagttggcagcggagcgcagcgctgcc
cagaagagcgacaatgcccgccagcagctggagcgacaaaacaaggagctgaaggccaag
ctgcaggagctggagggggcggtcaagtccaagttcaaagccaccatctcagccctggaa
gccaagattgggcagctggaggaacagctggagcaggaagccaaggaacgcgcagctgcc
aacaaactagtccgtcggacagagaagaaactgaaagagatcttcatgcaggtcgaagac
gagcgccggcatgcggatcagtataaggagcagatggagaaagccaatgccaggatgaag
cagcttaaacgccagctggaagaagctgaggaggaggctacacgtgccaatgcatctcgg
cgtaaactccaaagggaactggatgatgccaccgaggccaatgagggcctgagccgtgag
gtcagcactctcaagaaccggcttaggcggggcggcccaatcagcttttcttcaagccga
tctggccggcgccagctacacattgagggggcatcgctagagctgtcagatgacgacaca
gaaagcaagaccagtgatgtcaatgagacacagccaccccagtcggaatag

DBGET integrated database retrieval system