KEGG   Rattus norvegicus (rat): 79449
Entry
79449             CDS       T01003                                 

Gene name
Rpl21
Definition
(RefSeq) ribosomal protein L21
  KO
K02889  large subunit ribosomal protein L21e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    79449 (Rpl21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    79449 (Rpl21)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    79449 (Rpl21)
  Archaea
    79449 (Rpl21)
SSDB
Motif
Pfam: Ribosomal_L21e LYRIC CLP_protease
Other DBs
NCBI-GeneID: 79449
NCBI-ProteinID: NP_445782
RGD: 68390
Ensembl: ENSRNOG00000000957
UniProt: P20280
Position
12p11
AA seq 160 aa
MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGK
TGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAK
EKGTWVQLNGQPAPPREAHFVRTNGKEPELLEPIPYEFMA
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgaacacaaaaggaaagaggaggggtactcggtatatgttctctagaccttttagg
aaacatggagtcgttcctttggccacatacatgcgaatctacaagaagggtgatattgta
gacatcaagggaatgggcactgttcaaaaaggaatgccccataagtgttaccatggcaaa
accggaagagtctacaatgtcacccagcatgccgtgggcatcattgtgaacaagcaagtt
aaaggcaagattctggccaagaggatcaatgtgcggattgagcacatcaagcactcaaag
agcagagacagcttcctgaagcgggtgaaggagaacgatcagaagaaaaaggaagccaaa
gagaagggcacctgggttcagcttaacggccagcctgcgccacccagagaagcccacttt
gtgaggactaacggaaaggagcctgagctgctggagcccattccatacgaattcatggcc
taa

DBGET integrated database retrieval system