KEGG   Rattus norvegicus (rat): 79451
Entry
79451             CDS       T01003                                 

Gene name
Fabp4, Albp, aP2
Definition
(RefSeq) fatty acid binding protein 4
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    79451 (Fabp4)
   03320 PPAR signaling pathway
    79451 (Fabp4)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 79451
NCBI-ProteinID: NP_445817
RGD: 69309
Ensembl: ENSRNOG00000010805
UniProt: Q9R290
Position
2q23
AA seq 150 aa
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNLIISVEGDLVVIRSESTFKN
TEISFKLGVEFDEITPDDRKVKSIITLDGGVLVHVQKWDGKSTTIKRRXDGDKLVVECVM
KGVTSTRVYXRAXAKGRGPGLKFASNSTIT
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtgcgacgcctttgtggggacctggaaactcgtctccagtgagaacttcgatgattac
atgaaagaagtgggagttggcttcgccaccaggaaagtggccggtatggccaagcccaac
ttgatcatcagcgtagaaggggacttggtcgtcatccggtcagagagtacttttaaaaac
accgagatttccttcaaactgggcgtggaattcgatgaaatcaccccagatgacaggaaa
gtgaagagcatcataaccctggatggtggggtcctggtacatgtgcagaagtgggatgga
aagtcgaccaccataaagaggagacnagatggtgacaagctggtggtggaatgtgtcatg
aaaggcgtgacttctacaagagtttacnaaagggcatnagccaagggacgaggccctgga
ctgaaatttgcatcaaactctacaataacttga

DBGET integrated database retrieval system