KEGG   Rattus norvegicus (rat): 79463
Entry
79463             CDS       T01003                                 

Gene name
Timm22
Definition
(RefSeq) translocase of inner mitochondrial membrane 22
  KO
K17790  mitochondrial import inner membrane translocase subunit TIM22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    79463 (Timm22)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    79463 (Timm22)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM22 complex
    79463 (Timm22)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   79463 (Timm22)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 79463
NCBI-ProteinID: NP_116007
RGD: 68406
Ensembl: ENSRNOG00000007988
UniProt: Q9JKW1
Position
10q24
AA seq 192 aa
MAAAKAGASAPEAAGSAEAPLQYSLLLQHLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMI
ERAMESCAFKAVLACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAREVLKDMGQRG
MSYAKNFAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRAGVKAGAIGCGGF
AAFSAAIDYYLR
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcggccgccaaggctggggcttcagctcctgaggcggcgggttccgccgaagctccg
ttgcagtacagccttcttcttcagcacctggtgggcgacaagcgtcagccacggcttctg
gagcctggcagtctgggcgggatcccgagtcctgccaagagcgaggagcagaagatgatc
gagagggcgatggaaagttgcgccttcaaggctgtgctggcctgtgtgggaggatttgtc
ttgggaggcgcatttggtgtctttactgctggcattgataccaacgtgggctttgacccc
aaggacccttaccggacaccaactgcaagagaagtcctgaaggacatgggacagagagga
atgtcctatgccaaaaattttgccattgtgggtgccatgttttcctgtactgagtgtctg
gtagagtcttaccgggggaagtcagactggaagaacagcgtcatcagcggctgcatcact
ggtggagccatcggcttcagagctggagtaaaggccggggccataggttgtggaggtttt
gctgctttctctgctgcaatcgattattacctacggtga

DBGET integrated database retrieval system