KEGG   Rattus norvegicus (rat): 79557
Entry
79557             CDS       T01003                                 

Gene name
Chrna1
Definition
(RefSeq) cholinergic receptor nicotinic alpha 1 subunit
  KO
K04803  nicotinic acetylcholine receptor alpha-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    79557 (Chrna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    79557 (Chrna1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   79557 (Chrna1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb Claudin_2
Other DBs
NCBI-GeneID: 79557
NCBI-ProteinID: NP_077811
RGD: 69277
Ensembl: ENSRNOG00000018286
UniProt: P25108
Position
3q23
AA seq 457 aa
MELTAVLLLLGLCSAGTVLGSEHETRLVAKLFKDYSSVVRPVGDHREIVQVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDF
AIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPNTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTSLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHIMPEWVRKVFIDTIPNIMFFSTMKRPSRDKQEKR
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGVKYIAETMKSDQESNNASEEWK
YVAMVMDHILLGVFMLVCLIGTLAVFAGRLIELHQQG
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagctcaccgctgtcctcctgctgctgggcctctgctccgctggcactgttctgggc
tccgaacatgagactcgtctggtggcaaagctctttaaagactacagcagtgtggtccgg
ccagtaggggaccaccgtgagattgtacaggtcactgtgggactgcaactgatccagctt
atcaacgtggatgaagtaaatcagattgtgacaaccaacgttcgtctgaaacagcaatgg
gttgattacaacttgaaatggaatccagatgactatggaggagtgaaaaaaattcacatc
ccctcggaaaagatctggcggccggacgttgttctctataacaatgcagatggagacttt
gccattgtcaaattcaccaaggtgctcctggactacaccggtcacatcacctggacccct
ccagccatctttaaaagctactgtgagatcattgtcacccactttcccttcgatgagcag
aactgcagcatgaagctgggcacttggacctatgacggctctgtggtggccatcaatccg
gaaagtgaccagcccgacctgagtaacttcatggagagcggagagtgggtgatcaaggaa
gcccggggctggaagcactgggtgttttactcctgctgccccaacaccccttatctggac
atcacctaccacttcgtcatgcagcgtctgcctctctacttcattgtcaacgtcatcatt
ccctgcctgctcttctccttcttaaccagtctggtgttctacctgcccacagactcaggg
gagaagatgacgctgagcatctctgtcttactgtccctgactgtgttccttctcgtcatt
gtggagctgatcccttccacctctagcgctgtacccctgatcgggaagtacatgttgttt
accatggtctttgtcattgcgtccataataatcaccgtcattgtcatcaacacacaccac
cgttcgcccagcacccacatcatgcccgagtgggtgcggaaggtttttatcgacactatc
ccaaacatcatgtttttctccacaatgaaaagaccatccagagataaacaagaaaaaagg
attttcacagaagacatagatatctctgacatctctgggaagccggggcctccacctatg
ggctttcattctccactgatcaagcaccctgaggtgaaaagcgccattgagggtgtgaag
tacattgcagagaccatgaagtcagaccaggagtctaacaatgcgtctgaggagtggaag
tatgtcgccatggtgatggaccacatcctcctcggagtctttatgctggtgtgtctcatc
gggacgctggctgtgtttgcaggtcggctcattgagctacatcaacaaggatga

DBGET integrated database retrieval system