KEGG   Rattus norvegicus (rat): 79563
Entry
79563             CDS       T01003                                 

Gene name
Grpel1
Definition
(RefSeq) grpE protein homolog 1, mitochondrial precursor
  KO
K03687  molecular chaperone GrpE
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    79563 (Grpel1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    79563 (Grpel1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP24
   79563 (Grpel1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    79563 (Grpel1)
SSDB
Motif
Pfam: GrpE DUF2408 Sec34 THP2 GAT
Other DBs
NCBI-GeneID: 79563
NCBI-ProteinID: NP_077813
RGD: 70947
Ensembl: ENSRNOG00000006593
UniProt: P97576
Position
14
AA seq 217 aa
MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLEEDLGHCEPKTDPSSADKTL
LEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEK
ATQSVPKEEVSNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLDPIGAKFDPYEHEALFH
TPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcggctcggtgcgtgaggctggcgcggcgcagcctcccggctttggcgctgtcgttc
aggccttctcctcgcttgttgtgcacagctacaaaacaaaagaacaatggccagaacctg
gaagaggacttggggcattgtgagccaaagacagatccatcctctgcagacaagaccctc
ctggaagagaaggtgaagctggaagagcagctgaaggagaccatggaaaaatacaaacgt
gctttggcagataccgagaatctacggcagagaagccagaagctggtagaagaggccaag
ttatatggcatccagggtttctgcaaggacttgctggaggttgcagacatcctagagaag
gcaacccagagtgttccaaaggaggaggtcagcaacaacaaccctcacctgaagagtctt
tatgaagggctcgtgatgactgaagtccagattcagaaggtgttcacaaaacacggcttg
ctcaggcttgaccccattggggcaaagttcgacccttatgaacatgaggccttgttccac
acccctgtggaggggaaagaaccaggcactgtggcactagttagtaaggtgggctacaag
ctgcatggacgcaccctgaggccagctttggtgggggtggtgaaggacgcttag

DBGET integrated database retrieval system